HiSeq13708_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13708
Unique NameHiSeq13708_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length269
Homology
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|357624170|gb|EHJ75049.1| (hypothetical protein KGM_19145 [Danaus plexippus])

HSP 1 Score: 431.795 bits (1109), Expect = 2.525e-151
Identity = 223/267 (83.52%), Postives = 238/267 (89.14%), Query Frame = 0
Query:    7 MHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNS----ALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MHQSALYDFGDLFLKVS +YL +  + A NQ+RPVQTMNS    AL PV G+ V    GW+QHP LARAASVPA RALAGLL+ LGHRRLERT S+PAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGS+ASLSSG SL SYMSDGSRSPRSPHSPLTPQSPL PHSPPA++PP    AFAFRR QSP+PEE+RLPVFNRLSSAFGDL+IA
Sbjct:    1 MHQSALYDFGDLFLKVSSEYLTDDEVVATNQSRPVQTMNSTLSSALGPVGGTNVTASVGWDQHPVLARAASVPAQRALAGLLNSLGHRRLERTTSDPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSLASLSSGGSLASYMSDGSRSPRSPHSPLTPQSPLAPHSPPAMTPP--DYAFAFRRPQSPEPEEDRLPVFNRLSSAFGDLVIA 265          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|512914967|ref|XP_004928273.1| (PREDICTED: protein TIS11 isoform X1 [Bombyx mori])

HSP 1 Score: 427.172 bits (1097), Expect = 2.070e-149
Identity = 222/275 (80.73%), Postives = 238/275 (86.55%), Query Frame = 0
Query:    1 MMSTAIMHQSALYDFGDLFLKVSPDYLD--NGALTAINQTRPVQTMNS----ALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MMSTAIMHQSAL+DFGDLFLKVSP+ L      +   N TRPVQTMN     A+ P+  ++V  G  WEQHP L+RA+SVPAHRALAGLLDRLGHRRLERT SEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREP SPGGS+ASLSSG S+ SYMSDGSRSPRSPH      SPLTPHSPPA+SPPA ATAFAFRRT SPDPE++RLPVFNRLSSA GDL+IA
Sbjct:    1 MMSTAIMHQSALHDFGDLFLKVSPELLCLLQNEVETNNHTRPVQTMNGNIGGAIGPIGANSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLERTTSEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPSSPGGSLASLSSGGSMASYMSDGSRSPRSPH------SPLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVFNRLSSALGDLVIA 269          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|509188137|gb|JAA92189.1| (Protein TIS11 [Pararge aegeria])

HSP 1 Score: 425.246 bits (1092), Expect = 7.379e-149
Identity = 224/272 (82.35%), Postives = 235/272 (86.40%), Query Frame = 0
Query:    2 MSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMN----SALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MSTAIMHQSALYDFGDLFLK              NQTRPVQTMN    SAL PV  + V    GW+QHP LARAASVP+ RALAGLL  LGHRRLERT S+PAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGS+ASLSSG SL SYMSDGSRSPRSPHSPLTPQSP+ PHSPPA+SPPA AT+FAFRRT SP+ EEERLPVFNRLSSAFGDL+IA
Sbjct:    1 MSTAIMHQSALYDFGDLFLK--------------NQTRPVQTMNATLSSALGPVGATNVSASVGWDQHPVLARAASVPSQRALAGLLTSLGHRRLERTTSDPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSLASLSSGGSLTSYMSDGSRSPRSPHSPLTPQSPMAPHSPPAMSPPAHATSFAFRRTHSPELEEERLPVFNRLSSAFGDLVIA 258          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|512914971|ref|XP_004928274.1| (PREDICTED: protein TIS11 isoform X2 [Bombyx mori])

HSP 1 Score: 416.387 bits (1069), Expect = 2.472e-145
Identity = 218/273 (79.85%), Postives = 232/273 (84.98%), Query Frame = 0
Query:    1 MMSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNS----ALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MMSTAIMHQSAL+DFGDLFLK              N TRPVQTMN     A+ P+  ++V  G  WEQHP L+RA+SVPAHRALAGLLDRLGHRRLERT SEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREP SPGGS+ASLSSG S+ SYMSDGSRSPRSPH      SPLTPHSPPA+SPPA ATAFAFRRT SPDPE++RLPVFNRLSSA GDL+IA
Sbjct:    1 MMSTAIMHQSALHDFGDLFLK--------------NHTRPVQTMNGNIGGAIGPIGANSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLERTTSEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPSSPGGSLASLSSGGSMASYMSDGSRSPRSPH------SPLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVFNRLSSALGDLVIA 253          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|943934698|ref|XP_014358932.1| (PREDICTED: protein TIS11 isoform X1 [Papilio machaon])

HSP 1 Score: 387.497 bits (994), Expect = 9.152e-134
Identity = 215/280 (76.79%), Postives = 225/280 (80.36%), Query Frame = 0
Query:    2 MSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNSALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP------------GGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MSTAIMHQSALYDFGDLFLKVSP+Y ++G +   NQ RPVQTMNSAL    G+         +HPALARAASVP HRALAGLLDRLGHRRLERTASEPAPPP ATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP            G    S S+  SL SYMSDGSRSPRSPHS         PHS PALS PA A AFAFRRT SPDP++ERLPVFNRLSSAFGDLIIA
Sbjct:    1 MSTAIMHQSALYDFGDLFLKVSPEYQNDGGVKNFNQARPVQTMNSALNSALGAGGGAIGAGWEHPALARAASVP-HRALAGLLDRLGHRRLERTASEPAPPP-ATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSLASLSSGSGGSGSGSGSASGSLASYMSDGSRSPRSPHS---------PHS-PALS-PAHAGAFAFRRTHSPDPDDERLPVFNRLSSAFGDLIIA 267          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|913329884|ref|XP_013196437.1| (PREDICTED: protein TIS11 [Amyelois transitella])

HSP 1 Score: 386.341 bits (991), Expect = 3.345e-133
Identity = 225/275 (81.82%), Postives = 237/275 (86.18%), Query Frame = 0
Query:    2 MSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNSALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSYMSDG------SRSPRSPHSPLTPQSPLTPHSPPALSPPA-GATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MSTAIMHQSALY F DLFLK++P+Y  +G ++  NQ R VQTMN  + PVSG T+ GG  WEQHPALARAASVPAH+ALAGLLDRL HRRLERT SEP PPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHG RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREP SPGGS+ASLSSG SL SYMSDG        SP S HSPL PQSPLTPHSPPA+SPPA   TAFAFR TQSPDPEEERLPVFNRLSSAFGDL+IA
Sbjct:    1 MSTAIMHQSALYGFDDLFLKMTPEY--DGGISPSNQNRQVQTMNGTMGPVSGGTITGGVKWEQHPALARAASVPAHQALAGLLDRLVHRRLERTTSEPTPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGFRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPSSPGGSLASLSSGGSLASYMSDGSRSPRSPHSPHSSHSPLAPQSPLTPHSPPAMSPPAQQTTAFAFRPTQSPDPEEERLPVFNRLSSAFGDLVIA 273          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|910338522|ref|XP_013172865.1| (PREDICTED: protein TIS11-like isoform X1 [Papilio xuthus])

HSP 1 Score: 384.03 bits (985), Expect = 2.493e-132
Identity = 212/282 (75.18%), Postives = 222/282 (78.72%), Query Frame = 0
Query:    2 MSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNSALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP--------------GGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MSTAIMHQSALYDFGDLFLKVSP+Y ++G +   NQ RPVQTMNSAL    G+         +HPALARAASVP HRALAGLLDRLGHRRLERTASEPAPPP ATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP              G    S S+  SL SYMSDGSRSPRSPHS             PALS PA A AFAFRRT SPDP++ERLPVFNRLSSAFGDLIIA
Sbjct:    1 MSTAIMHQSALYDFGDLFLKVSPEYQNDGGVKNFNQARPVQTMNSALNSALGAGGGAIGAAWEHPALARAASVP-HRALAGLLDRLGHRRLERTASEPAPPP-ATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSLASLSSGSGGSGSGSGSGSASGSLASYMSDGSRSPRSPHS-------------PALS-PAHAGAFAFRRTHSPDPDDERLPVFNRLSSAFGDLIIA 266          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|943934702|ref|XP_014358941.1| (PREDICTED: protein TIS11 isoform X2 [Papilio machaon])

HSP 1 Score: 365.54 bits (937), Expect = 2.817e-125
Identity = 210/280 (75.00%), Postives = 216/280 (77.14%), Query Frame = 0
Query:    2 MSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNSALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP------------GGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MSTAIMHQSALYDFGDLFLK              NQ RPVQTMNSAL    G+         +HPALARAASVP HRALAGLLDRLGHRRLERTASEPAPPP ATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP            G    S S+  SL SYMSDGSRSPRSPHS         PHS PALS PA A AFAFRRT SPDP++ERLPVFNRLSSAFGDLIIA
Sbjct:    1 MSTAIMHQSALYDFGDLFLK--------------NQARPVQTMNSALNSALGAGGGAIGAGWEHPALARAASVP-HRALAGLLDRLGHRRLERTASEPAPPP-ATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSLASLSSGSGGSGSGSGSASGSLASYMSDGSRSPRSPHS---------PHS-PALS-PAHAGAFAFRRTHSPDPDDERLPVFNRLSSAFGDLIIA 253          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|910338524|ref|XP_013172866.1| (PREDICTED: protein TIS11-like isoform X2 [Papilio xuthus])

HSP 1 Score: 360.918 bits (925), Expect = 1.687e-123
Identity = 207/282 (73.40%), Postives = 213/282 (75.53%), Query Frame = 0
Query:    2 MSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNSALAPVSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP--------------GGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            MSTAIMHQSALYDFGDLFLK              NQ RPVQTMNSAL    G+         +HPALARAASVP HRALAGLLDRLGHRRLERTASEPAPPP ATSRYKTELCRPFEEAGVCKYGDKCQFAHG+RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSP              G    S S+  SL SYMSDGSRSPRSPHS             PALS PA A AFAFRRT SPDP++ERLPVFNRLSSAFGDLIIA
Sbjct:    1 MSTAIMHQSALYDFGDLFLK--------------NQARPVQTMNSALNSALGAGGGAIGAAWEHPALARAASVP-HRALAGLLDRLGHRRLERTASEPAPPP-ATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSLASLSSGSGGSGSGSGSGSASGSLASYMSDGSRSPRSPHS-------------PALS-PAHAGAFAFRRTHSPDPDDERLPVFNRLSSAFGDLIIA 252          
BLAST of HiSeq13708 vs. genbank:protein
Match: gi|1073535715|gb|JAT84969.1| (hypothetical protein g.17074, partial [Pectinophora gossypiella] >gi|1073538647|gb|JAT86435.1| hypothetical protein g.17084, partial [Pectinophora gossypiella] >gi|1073544861|gb|JAT89542.1| hypothetical protein g.17079, partial [Pectinophora gossypiella])

HSP 1 Score: 324.709 bits (831), Expect = 3.812e-110
Identity = 167/184 (90.76%), Postives = 175/184 (95.11%), Query Frame = 0
Query:   86 RLGHRRLERTASEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSYMSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEEERLPVFNRLSSAFGDLIIA 269
            RLGHRRLERT SEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREP SPGGS+ASLSSG S+ SYMS+GSRSPRSPHSPL PQSPLTPHSPPA+SPPA   AFAFRRT SPDP++ERLPVFNR+SSAFGDL+IA
Sbjct:    7 RLGHRRLERTTSEPAPPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRREPVSPGGSLASLSSGGSMASYMSEGSRSPRSPHSPLAPQSPLTPHSPPAMSPPAQPPAFAFRRTHSPDPDDERLPVFNRISSAFGDLVIA 190          
The following BLAST results are available for this feature:
BLAST of HiSeq13708 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357624170|gb|EHJ75049.1|2.525e-15183.52hypothetical protein KGM_19145 [Danaus plexippus][more]
gi|512914967|ref|XP_004928273.1|2.070e-14980.73PREDICTED: protein TIS11 isoform X1 [Bombyx mori][more]
gi|509188137|gb|JAA92189.1|7.379e-14982.35Protein TIS11 [Pararge aegeria][more]
gi|512914971|ref|XP_004928274.1|2.472e-14579.85PREDICTED: protein TIS11 isoform X2 [Bombyx mori][more]
gi|943934698|ref|XP_014358932.1|9.152e-13476.79PREDICTED: protein TIS11 isoform X1 [Papilio macha... [more]
gi|913329884|ref|XP_013196437.1|3.345e-13381.82PREDICTED: protein TIS11 [Amyelois transitella][more]
gi|910338522|ref|XP_013172865.1|2.493e-13275.18PREDICTED: protein TIS11-like isoform X1 [Papilio ... [more]
gi|943934702|ref|XP_014358941.1|2.817e-12575.00PREDICTED: protein TIS11 isoform X2 [Papilio macha... [more]
gi|910338524|ref|XP_013172866.1|1.687e-12373.40PREDICTED: protein TIS11-like isoform X2 [Papilio ... [more]
gi|1073535715|gb|JAT84969.1|3.812e-11090.76hypothetical protein g.17074, partial [Pectinophor... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0046872 metal ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000571Zinc finger, CCCH-typeSMARTSM00356ZnF_C3H1coord: 146..173
e-value: 1.2E-7
score: 41.4
coord: 108..135
e-value: 6.8E-9
score: 45.5
IPR000571Zinc finger, CCCH-typePFAMPF00642zf-CCCHcoord: 109..134
e-value: 4.8E-12
score: 45.1
coord: 147..172
e-value: 2.3E-9
score: 36.6
IPR000571Zinc finger, CCCH-typeGENE3D4.10.1000.10coord: 142..178
e-value: 7.8E-18
score: 63.2
coord: 103..140
e-value: 1.8E-18
score: 65.2
IPR000571Zinc finger, CCCH-typePROSITEPS50103ZF_C3H1coord: 146..174
score: 15.46
IPR000571Zinc finger, CCCH-typePROSITEPS50103ZF_C3H1coord: 108..136
score: 16.615
NoneNo IPR availablePANTHERPTHR12547CCCH ZINC FINGER/TIS11-RELATEDcoord: 108..263
NoneNo IPR availablePANTHERPTHR12547:SF58ZINC FINGER PROTEIN 36, C3H1 TYPE-LIKE 2coord: 108..263
NoneNo IPR availableSUPERFAMILY90229CCCH zinc fingercoord: 145..177
NoneNo IPR availableSUPERFAMILY90229CCCH zinc fingercoord: 107..140

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13708HiSeq13708Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13708_p ID=HiSeq13708_p|Name=HiSeq13708|organism=Ostrinia scapulalis|type=polypeptide|length=269bp
MMSTAIMHQSALYDFGDLFLKVSPDYLDNGALTAINQTRPVQTMNSALAP
VSGSTVVGGAGWEQHPALARAASVPAHRALAGLLDRLGHRRLERTASEPA
PPPPATSRYKTELCRPFEEAGVCKYGDKCQFAHGIRELRNLQRHPKYKTE
LCRTFHSVGFCPYGPRCHFVHNAEEARRREPPSPGGSVASLSSGVSLGSY
MSDGSRSPRSPHSPLTPQSPLTPHSPPALSPPAGATAFAFRRTQSPDPEE
ERLPVFNRLSSAFGDLIIA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR000571Znf_CCCH