HiSeq13713_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13713
Unique NameHiSeq13713_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length496
Homology
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|913298369|ref|XP_013192139.1| (PREDICTED: organic cation transporter protein isoform X2 [Amyelois transitella])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 412/490 (84.08%), Postives = 454/490 (92.65%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKK 495
            + ANYTE WNSS++L++IPLNEHGK++ C IYG N T+EEC  WVY+T+YFTSSRGIEWDFVCSR WMGA  QTAYMFGVVVGSLV+GR  DKFGRK  FVW+GLLQL+ G SVAF NEYYT +  RFLYGIFGSG YIAG+VL ME+VGPSKRT+CGV+FQIM+A+GIMLLAAWGYLIDNRFYLQILYALHA ILLPHWF MDESPRWLWAQGRARESVAIIEKAL +N S+E +DTP LVSHCKATCAKYTDEHSAGT+DLFKTPNMLKKTLIICGCWFANSVVY+GLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMY LDRVGHRALISTMMLLGG++C+VVVALPHG S+VTGVVM+GK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSM ASISGALTPLISLLD+LNPKIPTIIFGFLAL SGFSTF LPET GR+LPQS+EDGE+FG+GDTCFTNC+GRRMS+DS+++PETMVPLE +EKK
Sbjct:   59 DTANYTEPWNSSLILNAIPLNEHGKINECKIYGQNKTIEECSSWVYDTRYFTSSRGIEWDFVCSRNWMGAAIQTAYMFGVVVGSLVIGRLSDKFGRKAAFVWAGLLQLLLGVSVAFVNEYYTLVVFRFLYGIFGSGSYIAGYVLAMEIVGPSKRTICGVIFQIMYAIGIMLLAAWGYLIDNRFYLQILYALHAAILLPHWFIMDESPRWLWAQGRARESVAIIEKALKINGSHEIIDTPALVSHCKATCAKYTDEHSAGTSDLFKTPNMLKKTLIICGCWFANSVVYFGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYLLDRVGHRALISTMMLLGGLACIVVVALPHGHSSVTGVVMIGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMSASISGALTPLISLLDSLNPKIPTIIFGFLALFSGFSTFFLPETNGRNLPQSLEDGERFGLGDTCFTNCTGRRMSEDSINLPETMVPLEIMEKK 548          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|930651805|gb|KPI94147.1| (Organic cation transporter protein [Papilio xuthus])

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 411/490 (83.88%), Postives = 453/490 (92.45%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKK 495
            +  NYTE WNSS+V ++IPLNEHGKL+SC +YG N TL+EC+ WVY+T+Y+TSSRGIEWDFVCSRRWMGA  QTAYMFGVV+GS+VLGR CDK GRKT+FVWSG+LQL+ G +VAF  EYYTFI +RFLYGIFGSG YIAGFVLTMELVGP++RT+CGV FQIMFA+GIMLLAAWGYL+DNRFYLQILYALHA ILLPHW  MDESPRWLWAQGRARESVAIIEKAL +NK+NE+VDTP LVS CK TCAKYTDEHSAGT DLFKTPNML KTLII GCWFAN+VVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMY+LDRVGHRALIS M+LLGGISCLVVV LPHGS++ TGVVMVGK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLISLLDTLNPKIPT+IFGFLALLSGFSTF LPETIGR+LPQSIEDGEKFGVGDTCFTNCSG+ MS+ S+D+PETMVPL+  +K+
Sbjct:   68 DSMNYTEPWNSSLVRNAIPLNEHGKLESCYMYGVNKTLKECQSWVYDTKYYTSSRGIEWDFVCSRRWMGAAGQTAYMFGVVIGSVVLGRLCDKLGRKTIFVWSGILQLVLGVAVAFTTEYYTFIVVRFLYGIFGSGSYIAGFVLTMELVGPTRRTICGVTFQIMFAIGIMLLAAWGYLLDNRFYLQILYALHAVILLPHWIIMDESPRWLWAQGRARESVAIIEKALKVNKTNETVDTPSLVSQCKVTCAKYTDEHSAGTIDLFKTPNMLMKTLIISGCWFANAVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYYLDRVGHRALISAMLLLGGISCLVVVTLPHGSTSATGVVMVGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLISLLDTLNPKIPTVIFGFLALLSGFSTFFLPETIGRNLPQSIEDGEKFGVGDTCFTNCSGKAMSNSSLDLPETMVPLDAEKKQ 557          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|943977071|ref|XP_014369617.1| (PREDICTED: organic cation transporter protein isoform X2 [Papilio machaon])

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 410/490 (83.67%), Postives = 453/490 (92.45%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKK 495
            +  NYTE WNSS+V ++IP+NEHGKL+SC +YG N TL+EC+ WVY+T+Y+TSSRGIEWDFVCSRRWMGA  QTAYMFGVV+GS+VLGR CDK GRKT+FVWSG+ QL+ G +VAF  EYYTFIA+RFLYGIFGSG YIAGFVLTMELVGP++RT+CGV FQIMFA+GIMLLAAWGYL+DNRFYLQILYALHA ILLPHW  MDESPRWLWAQGRAR+SVAIIEKAL MNKSNE+VDTP LVS CK TCAKYTDEHSAGT DLFKTPNML KTLII GCWFAN+VVYYGLSLNTGKLNGNPYFIMFLMGVVELPSY+IIMY+LDRVGHRALIS M+LLGGISCLVVV LPHGS++ TGVVMVGK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLISLLDTLNPKIPT+IFGFLALLSGFSTF LPETIGR+LPQSIEDGEKFGVGDTCFTNCSG+ MS+ S+D+PETMVPL+  +K+
Sbjct:   59 DSMNYTEPWNSSLVQNAIPINEHGKLESCYMYGVNKTLKECQSWVYDTKYYTSSRGIEWDFVCSRRWMGAAGQTAYMFGVVIGSVVLGRLCDKIGRKTIFVWSGVFQLVLGVAVAFTTEYYTFIAVRFLYGIFGSGSYIAGFVLTMELVGPTRRTICGVTFQIMFAIGIMLLAAWGYLLDNRFYLQILYALHAVILLPHWIIMDESPRWLWAQGRARDSVAIIEKALRMNKSNETVDTPSLVSQCKVTCAKYTDEHSAGTIDLFKTPNMLMKTLIISGCWFANAVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYIIIMYYLDRVGHRALISAMLLLGGISCLVVVTLPHGSTSATGVVMVGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLISLLDTLNPKIPTVIFGFLALLSGFSTFFLPETIGRNLPQSIEDGEKFGVGDTCFTNCSGKTMSNSSLDLPETMVPLDAEKKQ 548          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|930665654|gb|KPJ06782.1| (Organic cation transporter protein, partial [Papilio machaon])

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 410/490 (83.67%), Postives = 453/490 (92.45%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKK 495
            +  NYTE WNSS+V ++IP+NEHGKL+SC +YG N TL+EC+ WVY+T+Y+TSSRGIEWDFVCSRRWMGA  QTAYMFGVV+GS+VLGR CDK GRKT+FVWSG+ QL+ G +VAF  EYYTFIA+RFLYGIFGSG YIAGFVLTMELVGP++RT+CGV FQIMFA+GIMLLAAWGYL+DNRFYLQILYALHA ILLPHW  MDESPRWLWAQGRAR+SVAIIEKAL MNKSNE+VDTP LVS CK TCAKYTDEHSAGT DLFKTPNML KTLII GCWFAN+VVYYGLSLNTGKLNGNPYFIMFLMGVVELPSY+IIMY+LDRVGHRALIS M+LLGGISCLVVV LPHGS++ TGVVMVGK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLISLLDTLNPKIPT+IFGFLALLSGFSTF LPETIGR+LPQSIEDGEKFGVGDTCFTNCSG+ MS+ S+D+PETMVPL+  +K+
Sbjct:   44 DSMNYTEPWNSSLVQNAIPINEHGKLESCYMYGVNKTLKECQSWVYDTKYYTSSRGIEWDFVCSRRWMGAAGQTAYMFGVVIGSVVLGRLCDKIGRKTIFVWSGVFQLVLGVAVAFTTEYYTFIAVRFLYGIFGSGSYIAGFVLTMELVGPTRRTICGVTFQIMFAIGIMLLAAWGYLLDNRFYLQILYALHAVILLPHWIIMDESPRWLWAQGRARDSVAIIEKALRMNKSNETVDTPSLVSQCKVTCAKYTDEHSAGTIDLFKTPNMLMKTLIISGCWFANAVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYIIIMYYLDRVGHRALISAMLLLGGISCLVVVTLPHGSTSATGVVMVGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLISLLDTLNPKIPTVIFGFLALLSGFSTFFLPETIGRNLPQSIEDGEKFGVGDTCFTNCSGKTMSNSSLDLPETMVPLDAEKKQ 533          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|910339559|ref|XP_013173421.1| (PREDICTED: organic cation transporter protein isoform X2 [Papilio xuthus])

HSP 1 Score: 876.315 bits (2263), Expect = 0.000e+0
Identity = 410/490 (83.67%), Postives = 452/490 (92.24%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKK 495
            +  NYTE WNSS+V ++IPLNEHGKL+SC +YG N TL+EC+ WVY+T+Y+TSSRGIEWDFVCSRRWMGA  QTAYMFGVV+GS+VLGR CDK GRKT+FVWSG+LQL+ G +VAF  EYYTF  +RFLYGIFGSG YIAGFVLTMELVGP++RT+CGV FQIMFA+GIMLLAAWGYL+DNRFYLQILYALHA ILLPHW  MDESPRWLWAQGRARESVAIIEKAL +NK+NE+VDTP LVS CK TCAKYTDEHSAGT DLFKTPNML KTLII GCWFAN+VVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMY+LDRVGHRALIS M+LLGGISCLVVV LPHGS++ TGVVMVGK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLISLLDTLNPKIPT+IFGFLALLSGFSTF LPETIGR+LPQSIEDGEKFGVGDTCFTNCSG+ MS+ S+D+PETMVPL+  +K+
Sbjct:   59 DSMNYTEPWNSSLVRNAIPLNEHGKLESCYMYGVNKTLKECQSWVYDTKYYTSSRGIEWDFVCSRRWMGAAGQTAYMFGVVIGSVVLGRLCDKLGRKTIFVWSGILQLVLGVAVAFTTEYYTFTVVRFLYGIFGSGSYIAGFVLTMELVGPTRRTICGVTFQIMFAIGIMLLAAWGYLLDNRFYLQILYALHAVILLPHWIIMDESPRWLWAQGRARESVAIIEKALKVNKTNETVDTPSLVSQCKVTCAKYTDEHSAGTIDLFKTPNMLMKTLIISGCWFANAVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYYLDRVGHRALISAMLLLGGISCLVVVTLPHGSTSATGVVMVGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLISLLDTLNPKIPTVIFGFLALLSGFSTFFLPETIGRNLPQSIEDGEKFGVGDTCFTNCSGKAMSNSSLDLPETMVPLDAEKKQ 548          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|909556347|ref|XP_013149714.1| (PREDICTED: organic cation transporter protein [Papilio polytes])

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 412/490 (84.08%), Postives = 453/490 (92.45%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKK 495
            +  NYTE WNS++V ++IP+NEHGKL+SC +YG N TL+EC+ WVY+T+Y+TSSRGIEWDFVCSRRWMGAT QTAYMFGVVVGS+VLGR CDK GRKT+FV SG+LQL FG +VAF  EYYTFI +RFLYGIFGSG YIAGFVLTMELVGP++RT+CGV FQIMFA+GIMLLAAWGYL+DNRFYLQILYALHA ILLPHW  MDESPRWLWAQGRARESVAIIEKAL +NKSNE+VDTP LVS CK TCAKYTDEHSAGT DLFKTPNML KTLII GCWFAN+VVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMY+LDRVGHRALIS M+LLGGISC+VVVALPHGS++ TGVVMVGK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLISLLDTLNPKIPT+IFGFLALLSGFSTF LPETIGR+LPQSIEDGEKFGVGDTCFTNCSG+ MS  S+D+PETMVPL+  +K+
Sbjct:   59 DSINYTEPWNSTLVQNAIPINEHGKLESCYVYGVNKTLKECQSWVYDTKYYTSSRGIEWDFVCSRRWMGATGQTAYMFGVVVGSVVLGRLCDKLGRKTIFVLSGVLQLAFGITVAFTTEYYTFIVVRFLYGIFGSGSYIAGFVLTMELVGPTRRTICGVTFQIMFAIGIMLLAAWGYLLDNRFYLQILYALHAVILLPHWLIMDESPRWLWAQGRARESVAIIEKALKVNKSNETVDTPSLVSQCKVTCAKYTDEHSAGTIDLFKTPNMLMKTLIISGCWFANAVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYYLDRVGHRALISAMLLLGGISCIVVVALPHGSTSATGVVMVGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLISLLDTLNPKIPTVIFGFLALLSGFSTFFLPETIGRNLPQSIEDGEKFGVGDTCFTNCSGKTMSTSSLDLPETMVPLDAEKKQ 548          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|914576142|gb|KOB78065.1| (Uncharacterized protein OBRU01_03113, partial [Operophtera brumata])

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 397/488 (81.35%), Postives = 445/488 (91.19%), Query Frame = 0
Query:    9 NYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKKG 496
            N+T+ WNSS VL+SIP+NEHGKL+SC ++G N TL EC  WVY+TQY++SSR IEWDFVCSRRWMGA+AQTAYMFGVV GSL+ GR  DKFGRKT F+WSG+LQLI G+SVA AN+YYTFI +RF+YGIFGSG YIAGFVLTME+VGPSKRT+CGV+FQIMFA+G+MLL AW YLIDNRF LQI+YALHA +LLPHW  MDESPRWLWAQGRARESVAI+EKAL  N S E+VDT LLVSHCKATCAKYTDEHSAGTTDLFKTP ML+KTLIICGCWF N+VVYYGLSLN GKLNGNPYF+MFLMGVVELPSYVIIMYFLD+VGHRALISTMM+LGG++CLV+VALPHG+ + TG+VM+GK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLI+LLDTLNPKIPTIIFG LALLSGFS F LPET+GR+LPQS+EDGEKFGVGD CFTNCSG+ MSD S D+PETMVPL+  EKKG
Sbjct:   30 NHTQPWNSSQVLESIPVNEHGKLESCVMFGANKTLRECTSWVYDTQYYSSSRAIEWDFVCSRRWMGASAQTAYMFGVVAGSLLFGRLSDKFGRKTAFLWSGILQLILGSSVALANDYYTFIVLRFIYGIFGSGSYIAGFVLTMEIVGPSKRTICGVMFQIMFAIGLMLLPAWAYLIDNRFLLQIIYALHAAVLLPHWLLMDESPRWLWAQGRARESVAIVEKALKFNNSTETVDTSLLVSHCKATCAKYTDEHSAGTTDLFKTPKMLQKTLIICGCWFTNAVVYYGLSLNAGKLNGNPYFLMFLMGVVELPSYVIIMYFLDKVGHRALISTMMMLGGVACLVIVALPHGAPSTTGIVMLGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLINLLDTLNPKIPTIIFGLLALLSGFSAFFLPETVGRNLPQSLEDGEKFGVGDNCFTNCSGKNMSDSSEDLPETMVPLDG-EKKG 516          

HSP 2 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 288/489 (58.90%), Postives = 363/489 (74.23%), Query Frame = 0
Query:    7 DANYT-ESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGS-GPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSD---DSVDIPETMVPLE 490
            D N +  +WNSS +L +IP    G L +C +Y  N T   C +WVY+  Y +SSR IEWD VC +RWMGA AQT YM GV  G++VLG   DK+GRKT++ WSG+LQLIFG  VAF  EY++F+A+RFLYGIFGS G YI GFVLTME+VG SKRT CGV FQ  FA GIML+A WG LIDNR  LQ++Y LH  +L+PH + MDESPRWLWAQGRA+ESV I+E+AL  N+S  ++D   LVS  KA  +K +++ SA T DLFKTPN+  KTL +C CWFANS+ YYGL+L+TGKL GNPY I  ++G VE PSY  ++YFLD  G R LIS+MML+GG SC++   LP+GS   TG+V+ GK+FI+GS++IIY YSAELFPTVVR+S +GLGSMCA +SGALTPLISLLD+ NPKIP +IFG +AL+SGF  F LPET+ + +PQ++ DGE+FG GDT F +C G++      +     E MVPL+
Sbjct:  518 DTNVSIAAWNSSEILAAIPKTISGDLHNCLMYQDNQT-TSCSKWVYDDTYRSSSRAIEWDLVCDKRWMGALAQTIYMLGVFTGAVVLGGMADKYGRKTIYCWSGVLQLIFGVLVAFIPEYWSFLAVRFLYGIFGSAGSYITGFVLTMEIVGASKRTACGVAFQAAFAGGIMLVAGWGALIDNRQILQVIYGLHGLLLIPHIWIMDESPRWLWAQGRAKESVEIVERALKCNRSEHTLDKADLVSRGKAEASKASNDPSASTLDLFKTPNLRNKTLNVCLCWFANSIAYYGLTLSTGKLEGNPYLITAILGFVEFPSYAAVVYFLDIWGRRPLISSMMLVGGASCIIATLLPNGSMVSTGIVIAGKLFIAGSFAIIYNYSAELFPTVVRNSALGLGSMCARLSGALTPLISLLDSFNPKIPAVIFGVVALVSGFMCFFLPETMNQPMPQTLADGERFGKGDTAFASCLGKKKDKPYTEEDKTAEAMVPLD 1005          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|357628601|gb|EHJ77873.1| (hypothetical protein KGM_18688 [Danaus plexippus])

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 399/485 (82.27%), Postives = 441/485 (90.93%), Query Frame = 0
Query:    6 EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLE 490
            + +NYT SWNSS VL++IPLN HGKL+SC IYG NNTL+ CE WVYNTQYFTSSRGIEWDFVCSRRWMGA AQTAYMFGVV+GS VLGR CDKFGRKTVFVW+G+ QLIFG+ VA A +YYTFI +RF+YGIFGSG YIAGFVLTMELVGPS+RT+CGV FQIMFA+GIML+A WGY++DNRFYLQILY LHA ILLPHWF MDES RWLW+QGRARESVA+IEKAL MN SNE ++T  LVS CKATCAKY+D+ +AGT DLFK+PNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYF+ FL G+VELPSY+II+Y LDRVGHRALISTMML GGI+CLVVVALPHGS++VTGVVM+GK+FISGSYSIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLISLLDTLNPKIPTIIFG LALLSGFSTF LPETIG++LPQS+EDGEKFGV DTCFTNC GRRMS  S D+PE M PL+
Sbjct:   59 DSSNYTASWNSSFVLNAIPLNSHGKLESCKIYGENNTLQTCESWVYNTQYFTSSRGIEWDFVCSRRWMGAAAQTAYMFGVVMGSFVLGRFCDKFGRKTVFVWAGVFQLIFGSLVALATQYYTFIVLRFVYGIFGSGSYIAGFVLTMELVGPSRRTICGVAFQIMFAVGIMLVAGWGYILDNRFYLQILYGLHALILLPHWFLMDESIRWLWSQGRARESVALIEKALKMNGSNEIIETSALVSQCKATCAKYSDDEAAGTGDLFKSPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFLTFLFGIVELPSYIIIVYCLDRVGHRALISTMMLFGGIACLVVVALPHGSNSVTGVVMIGKLFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLISLLDTLNPKIPTIIFGLLALLSGFSTFFLPETIGKELPQSVEDGEKFGVNDTCFTNCVGRRMSTASEDLPEAMEPLD 543          

HSP 2 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 283/486 (58.23%), Postives = 350/486 (72.02%), Query Frame = 0
Query:   14 WNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGS-GPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSV---DIPETMVPLEPIEKK 495
            WNSS +L SIPL   G L SC +Y   N    C +WVY+++Y TSSRGI+WD VC +RW GA AQT YM GV  G++ LG   DK GRK VF  S +LQLI G  VAF  EY+TF+ I + Y IFGS G YI  FVLTMELVGPSKRT+CGV FQ  FALGIML+A WG LIDNR  LQ++Y LH  IL+PH + MDESPRWLWAQGR +E+V I++KAL  NKS++ +D  +LVS  K   +K T E SA   DLFKTPN+  KTL +C CWFANS+VYYGL+L+ GKL GNPY I  + G+VELPSY  ++YFLD  G R L+++MML+GG +C++   +       T VV+ GK+FI+GS++IIY YSAELFPTVVR+S +GLGSMCA  SGALTPLI+LLD+ +PKIP   FG +A++SGF  F LPET+   +PQS+EDGE FG G+TCFT+C G+R S DS    D  E MV L+ + KK
Sbjct:  568 WNSSEILKSIPLTSTGSLSSCLMYNEENITVTCNKWVYDSKYRTSSRGIDWDLVCDQRWRGALAQTMYMLGVFTGAVYLGGLADKIGRKKVFCMSAVLQLILGVVVAFIPEYWTFVVITYFYAIFGSAGAYIPAFVLTMELVGPSKRTICGVAFQATFALGIMLVAGWGALIDNRVVLQVIYGLHGLILIPHIWIMDESPRWLWAQGRPKEAVDIVQKALKYNKSDKVLDRAVLVSKGKVEKSKNT-ESSASVFDLFKTPNLRIKTLNVCLCWFANSLVYYGLTLSAGKLEGNPYLITAVFGLVELPSYAAVVYFLDIWGRRPLMTSMMLVGGSACIIAAFIDPDYIVSTVVVIAGKLFIAGSFAIIYNYSAELFPTVVRNSAIGLGSMCARFSGALTPLITLLDSFDPKIPAATFGLVAIVSGFLCFFLPETMNHPMPQSLEDGENFGKGETCFTSCLGKRDSIDSYNADDKAEEMVALDDMSKK 1052          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|827536538|ref|XP_012553440.1| (PREDICTED: organic cation transporter protein isoform X2 [Bombyx mori])

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 381/496 (76.81%), Postives = 431/496 (86.90%), Query Frame = 0
Query:    2 CXLY--EDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNT-LEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEK 494
            C L+  +  N T SWNSS+V+ +IP+NE+ K DSC +Y  N+T   ECE WVYNTQYF+SSRGIEW+FVC++RWMGA AQT YMFGVV GSL+ GR  DK+GRKT FVWSG++QL+ G  VA  NEYY+F+ +RF+YGIFGSG YI GFVLTMELVGPSKRT+CGV FQ+MFA+GIML+ AWGYLIDNRFYLQILY LHA +LLPHWF MDESPRWLW+QGRARESVAIIEKAL MN   E++DT  L+S CKAT AKY+DE SAGT DLFKTP MLKKTLIICGCWF NSVVYYG+SLN GKLNGNPYF+MFLMG+VELPSYVII YFLDRVGHRALISTMMLLGGI+CLV+  LPHGS T TG+VMVGK+FISGS+SIIYKYSAELFPTVVRSSGVGLGSMCAS+SGALTPLI+LLDTLNPKIPTI+FGFLAL SGFSTF LPETIGR LPQS+EDGEKFG+GD CFTNCSG+ ++D   DIPETMVPL+  +K
Sbjct:   53 CFLHGIDSYNATNSWNSSLVMAAIPVNENDKFDSCRMYTRNHTSTAECESWVYNTQYFSSSRGIEWNFVCNQRWMGAIAQTVYMFGVVGGSLIFGRISDKYGRKTAFVWSGVMQLLLGVLVALTNEYYSFLVVRFIYGIFGSGAYITGFVLTMELVGPSKRTICGVTFQVMFAIGIMLVPAWGYLIDNRFYLQILYGLHAALLLPHWFIMDESPRWLWSQGRARESVAIIEKALKMNGITENIDTSSLISQCKATNAKYSDEQSAGTNDLFKTPRMLKKTLIICGCWFTNSVVYYGISLNAGKLNGNPYFLMFLMGIVELPSYVIITYFLDRVGHRALISTMMLLGGIACLVIFFLPHGSITTTGMVMVGKLFISGSFSIIYKYSAELFPTVVRSSGVGLGSMCASVSGALTPLINLLDTLNPKIPTILFGFLALFSGFSTFFLPETIGRHLPQSLEDGEKFGIGDNCFTNCSGQPLTDSIPDIPETMVPLDENKK 548          
BLAST of HiSeq13713 vs. genbank:protein
Match: gi|768429491|ref|XP_011555928.1| (PREDICTED: organic cation transporter protein [Plutella xylostella])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 298/493 (60.45%), Postives = 365/493 (74.04%), Query Frame = 0
Query:    9 NYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWVYNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFGRKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGS-GPYIAGFVLTMELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATILLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHCKATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTGKLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLVVVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGSMCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDLPQSIEDGEKFGVGDTCFTNCSG----RRMSDDSVDIPETMVPLEPIEKKG 496
            N T  WNSS++L +IPL   G L +C IY  NN    C+ WVY+T Y TSSR IEWD VC +RW G+ AQTAYM GV  G++VLG   DK GRK +F WS +LQL+FG  VA+  EY+T +A +FLYGIFGS G YI GFVLTMELVGPSKRT+CGV+FQ  FA GIML+AAWG LIDNR  LQ +Y LH  +L+PH + MDESPRWLWAQGR +ES+ I+EKAL  N+S+E +D   LVS  KA  +K  +  SA   DLFKTPN+  KTL IC C+FANS+VYYGLSL+TGKL GNPYFI+ +MG VELPSY  ++YFLD  G R +IS+MML+GG +C+    +P G    T VVMVGK+FI+GS++I+Y YSAELFPTVVR+S +GLGSMCA  SGALTPLI+LLD+ NPKIP IIFG +A++SGF   +LPET+ + +PQS+EDGE FG GDTCFT+C G     R   +S    E MVPLE + +KG
Sbjct:   62 NTTAPWNSSLILSAIPLTPTGDLHNCLIY-RNNESVSCDRWVYDTTYRTSSRAIEWDLVCDQRWRGSLAQTAYMLGVFTGAVVLGGLADKMGRKIIFCWSAVLQLLFGILVAYIPEYWTLLAFQFLYGIFGSAGSYITGFVLTMELVGPSKRTICGVMFQATFAAGIMLVAAWGALIDNRQLLQTIYGLHGLLLIPHIWIMDESPRWLWAQGRVKESIDIVEKALKCNRSDERLDRAQLVSRGKAESSKGAEAPSASVMDLFKTPNLRNKTLNICLCFFANSIVYYGLSLSTGKLEGNPYFILAIMGFVELPSYAAVIYFLDIWGRRPMISSMMLVGGAACIAASFVPSGGLLSTAVVMVGKLFIAGSFAIVYNYSAELFPTVVRNSALGLGSMCARTSGALTPLITLLDSFNPKIPAIIFGVVAIVSGFLCLVLPETMDKPMPQSLEDGETFGAGDTCFTSCLGWRERNRTYSESDKTAEVMVPLESVSRKG 553          
The following BLAST results are available for this feature:
BLAST of HiSeq13713 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913298369|ref|XP_013192139.1|0.000e+084.08PREDICTED: organic cation transporter protein isof... [more]
gi|930651805|gb|KPI94147.1|0.000e+083.88Organic cation transporter protein [Papilio xuthus... [more]
gi|943977071|ref|XP_014369617.1|0.000e+083.67PREDICTED: organic cation transporter protein isof... [more]
gi|930665654|gb|KPJ06782.1|0.000e+083.67Organic cation transporter protein, partial [Papil... [more]
gi|910339559|ref|XP_013173421.1|0.000e+083.67PREDICTED: organic cation transporter protein isof... [more]
gi|909556347|ref|XP_013149714.1|0.000e+084.08PREDICTED: organic cation transporter protein [Pap... [more]
gi|914576142|gb|KOB78065.1|0.000e+081.35Uncharacterized protein OBRU01_03113, partial [Ope... [more]
gi|357628601|gb|EHJ77873.1|0.000e+082.27hypothetical protein KGM_18688 [Danaus plexippus][more]
gi|827536538|ref|XP_012553440.1|0.000e+076.81PREDICTED: organic cation transporter protein isof... [more]
gi|768429491|ref|XP_011555928.1|0.000e+060.45PREDICTED: organic cation transporter protein [Plu... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0022857 transmembrane transporter activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828General substrate transporterPFAMPF00083Sugar_trcoord: 72..450
e-value: 3.3E-31
score: 108.2
NoneNo IPR availableGENE3D1.20.1250.20coord: 275..449
e-value: 3.9E-18
score: 64.9
coord: 75..213
e-value: 4.0E-16
score: 58.4
NoneNo IPR availablePANTHERPTHR24064:SF211SUBFAMILY NOT NAMEDcoord: 23..495
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 23..495
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 72..92
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 422..442
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 278..295
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 329..334
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 417..421
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 384..394
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 183..187
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 335..354
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 307..328
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 188..207
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 395..416
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 161..182
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 93..103
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 104..122
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 150..160
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 443..496
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..71
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 296..306
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 208..277
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 123..127
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 128..149
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 355..359
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 360..383
NoneNo IPR availableTMHMMTMhelixcoord: 74..96
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 162..184
NoneNo IPR availableTMHMMTMhelixcoord: 103..122
NoneNo IPR availableTMHMMTMhelixcoord: 279..296
NoneNo IPR availableTMHMMTMhelixcoord: 188..207
NoneNo IPR availableTMHMMTMhelixcoord: 425..442
NoneNo IPR availableTMHMMTMhelixcoord: 335..354
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 358..380
NoneNo IPR availableTMHMMTMhelixcoord: 306..328
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 1..447
score: 15.142
IPR020846Major facilitator superfamily domainSUPERFAMILY103473MFS general substrate transportercoord: 75..452

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13713HiSeq13713Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13713_p ID=HiSeq13713_p|Name=HiSeq13713|organism=Ostrinia scapulalis|type=polypeptide|length=496bp
MCXLYEDANYTESWNSSIVLDSIPLNEHGKLDSCNIYGPNNTLEECEEWV
YNTQYFTSSRGIEWDFVCSRRWMGATAQTAYMFGVVVGSLVLGRACDKFG
RKTVFVWSGLLQLIFGASVAFANEYYTFIAIRFLYGIFGSGPYIAGFVLT
MELVGPSKRTVCGVVFQIMFALGIMLLAAWGYLIDNRFYLQILYALHATI
LLPHWFAMDESPRWLWAQGRARESVAIIEKALIMNKSNESVDTPLLVSHC
KATCAKYTDEHSAGTTDLFKTPNMLKKTLIICGCWFANSVVYYGLSLNTG
KLNGNPYFIMFLMGVVELPSYVIIMYFLDRVGHRALISTMMLLGGISCLV
VVALPHGSSTVTGVVMVGKMFISGSYSIIYKYSAELFPTVVRSSGVGLGS
MCASISGALTPLISLLDTLNPKIPTIIFGFLALLSGFSTFLLPETIGRDL
PQSIEDGEKFGVGDTCFTNCSGRRMSDDSVDIPETMVPLEPIEKKG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR020846MFS_dom
IPR005828Sub_transporter