HiSeq13727_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13727
Unique NameHiSeq13727_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length33
Homology
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|910350399|ref|XP_013179260.1| (PREDICTED: epidermal growth factor receptor isoform X3 [Papilio xuthus])

HSP 1 Score: 70.0922 bits (170), Expect = 3.260e-13
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1386 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1418          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|913316758|ref|XP_013189331.1| (PREDICTED: epidermal growth factor receptor isoform X2 [Amyelois transitella])

HSP 1 Score: 70.0922 bits (170), Expect = 3.524e-13
Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            PRPGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1392 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1424          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|913316756|ref|XP_013189330.1| (PREDICTED: epidermal growth factor receptor isoform X1 [Amyelois transitella])

HSP 1 Score: 70.0922 bits (170), Expect = 3.847e-13
Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            PRPGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1417 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1449          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|930653848|gb|KPI96184.1| (Epidermal growth factor receptor [Papilio xuthus])

HSP 1 Score: 69.707 bits (169), Expect = 5.160e-13
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1256 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1288          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|910350395|ref|XP_013179258.1| (PREDICTED: epidermal growth factor receptor isoform X1 [Papilio xuthus])

HSP 1 Score: 68.1662 bits (165), Expect = 1.478e-12
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1402 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1434          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|909569019|ref|XP_013139991.1| (PREDICTED: epidermal growth factor receptor [Papilio polytes])

HSP 1 Score: 68.1662 bits (165), Expect = 1.493e-12
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1399 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1431          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|943969477|ref|XP_014366514.1| (PREDICTED: epidermal growth factor receptor isoform X2 [Papilio machaon])

HSP 1 Score: 68.1662 bits (165), Expect = 1.493e-12
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1377 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1409          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|943969474|ref|XP_014366513.1| (PREDICTED: epidermal growth factor receptor isoform X1 [Papilio machaon])

HSP 1 Score: 68.1662 bits (165), Expect = 1.537e-12
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1399 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1431          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|910350397|ref|XP_013179259.1| (PREDICTED: epidermal growth factor receptor isoform X2 [Papilio xuthus])

HSP 1 Score: 68.1662 bits (165), Expect = 1.552e-12
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1399 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1431          
BLAST of HiSeq13727 vs. genbank:protein
Match: gi|930668161|gb|KPJ09202.1| (Epidermal growth factor receptor [Papilio machaon])

HSP 1 Score: 68.1662 bits (165), Expect = 1.553e-12
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
Query:    1 PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH 33
            P+PGTSKYLPQRSVEEESMSDHEYYNDLQREL 
Sbjct: 1347 PQPGTSKYLPQRSVEEESMSDHEYYNDLQRELQ 1379          
The following BLAST results are available for this feature:
BLAST of HiSeq13727 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|910350399|ref|XP_013179260.1|3.260e-1393.94PREDICTED: epidermal growth factor receptor isofor... [more]
gi|913316758|ref|XP_013189331.1|3.524e-1396.97PREDICTED: epidermal growth factor receptor isofor... [more]
gi|913316756|ref|XP_013189330.1|3.847e-1396.97PREDICTED: epidermal growth factor receptor isofor... [more]
gi|930653848|gb|KPI96184.1|5.160e-1393.94Epidermal growth factor receptor [Papilio xuthus][more]
gi|910350395|ref|XP_013179258.1|1.478e-1293.94PREDICTED: epidermal growth factor receptor isofor... [more]
gi|909569019|ref|XP_013139991.1|1.493e-1293.94PREDICTED: epidermal growth factor receptor [Papil... [more]
gi|943969477|ref|XP_014366514.1|1.493e-1293.94PREDICTED: epidermal growth factor receptor isofor... [more]
gi|943969474|ref|XP_014366513.1|1.537e-1293.94PREDICTED: epidermal growth factor receptor isofor... [more]
gi|910350397|ref|XP_013179259.1|1.552e-1293.94PREDICTED: epidermal growth factor receptor isofor... [more]
gi|930668161|gb|KPJ09202.1|1.553e-1293.94Epidermal growth factor receptor [Papilio machaon][more]

Pages

back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13727HiSeq13727Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13727_p ID=HiSeq13727_p|Name=HiSeq13727|organism=Ostrinia scapulalis|type=polypeptide|length=33bp
PRPGTSKYLPQRSVEEESMSDHEYYNDLQRELH
back to top