HiSeq13747_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13747
Unique NameHiSeq13747_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length198
Homology
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|930655198|gb|KPI97529.1| (Larval cuticle protein LCP-30 [Papilio xuthus])

HSP 1 Score: 316.62 bits (810), Expect = 5.288e-108
Identity = 150/197 (76.14%), Postives = 175/197 (88.83%), Query Frame = 0
Query:    1 MYSTEAVLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            M  T ++L  IA+C++ VAG+P EDGKWHPYKYG +GKYIPTDEGKYIHIPNPYIHI+NPY+GG+GPY+HDYEPYV  AT DRY+ V+TPP ++ PYYKDGYY+NNGIKII QKH Y+EDKYDF+FETENKIRA+E A +KNPNT DEGIAS GFYEY+GPDGF+YRVDYTADENGFRP  +R+ETPYSGKWVL+KV
Sbjct:    1 MTLTISILYIIAICVVAVAGTPEEDGKWHPYKYGQNGKYIPTDEGKYIHIPNPYIHIDNPYNGGFGPYTHDYEPYVSAATEDRYRLVMTPPKDI-PYYKDGYYKNNGIKIISQKHVYDEDKYDFNFETENKIRAKENAILKNPNTIDEGIASSGFYEYLGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWVLEKV 196          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|223671103|tpd|FAA00503.1| (TPA: putative cuticle protein [Bombyx mori])

HSP 1 Score: 316.235 bits (809), Expect = 6.804e-108
Identity = 151/192 (78.65%), Postives = 174/192 (90.62%), Query Frame = 0
Query:    7 VLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATV-DRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            V   IA+C++   G P+EDGKWHPY YGD GKYIPTDEGKYIHIPNPYIHI+NPYDGG+GPY+HDYEPYVGEATV D+Y+ +LTPP + +P+YKDGYY+NNGIKII+QKHNY+EDKYDFDFETENKIRAEEKA +KN N+ DEGIASKGFYEYIGPDGF+YRVDYTADENGFRP  +R+ETPYSGKW+L+KV
Sbjct:    6 VQYVIALCVVAAVGVPVEDGKWHPYHYGDSGKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYRLILTPPKD-IPFYKDGYYKNNGIKIIKQKHNYDEDKYDFDFETENKIRAEEKAVLKNANSIDEGIASKGFYEYIGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWILEKV 196          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|56462130|gb|AAV91348.1| (cuticle protein 3 [Lonomia obliqua])

HSP 1 Score: 315.464 bits (807), Expect = 1.418e-107
Identity = 152/196 (77.55%), Postives = 176/196 (89.80%), Query Frame = 0
Query:    3 STEAVLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATV-DRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            ++  V   IA+C++ V G PLEDGKWHPYKYGD G+YIP+DEGKYIHIPNPYIH++NPY GG+GPY+HDYEPYVGEA+V D+Y+ VLT P + +P+Y+DGYY+NNGIKIIRQKHNY+EDKYDFDFETENKIRAEEKA IKNPNT DEGIAS+GFYEYIGPDGF+YRVDYTADENGFRP  RR+ETPYSGKW L+KV
Sbjct:    2 NSVKVQYVIALCVVAVVGIPLEDGKWHPYKYGDSGRYIPSDEGKYIHIPNPYIHLDNPYGGGFGPYAHDYEPYVGEASVQDQYRLVLTDPKD-IPFYQDGYYKNNGIKIIRQKHNYKEDKYDFDFETENKIRAEEKAVIKNPNTIDEGIASQGFYEYIGPDGFMYRVDYTADENGFRPKIRRLETPYSGKWTLEKV 196          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|114051552|ref|NP_001040112.1| (cuticular protein RR-1 motif 1 precursor [Bombyx mori] >gi|87248093|gb|ABD36099.1| cuticle protein 3 [Bombyx mori])

HSP 1 Score: 314.694 bits (805), Expect = 3.262e-107
Identity = 151/192 (78.65%), Postives = 173/192 (90.10%), Query Frame = 0
Query:    7 VLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATV-DRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            V   IA+CI+   G P+EDGKWHPY YGD GKYIPTDEGKYIHIPNPYIHI+NPYDGG+GPY+HDYEPYVGEATV D+Y+ +LTPP + +P+YKDGYY+N GIKII+QKHNY+EDKYDFDFETENKIRAEEKA +KN N+ DEGIASKGFYEYIGPDGF+YRVDYTADENGFRP  +R+ETPYSGKW+L+KV
Sbjct:    6 VQYVIALCIVAAVGVPVEDGKWHPYHYGDSGKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYRLILTPPKD-IPFYKDGYYKNKGIKIIKQKHNYDEDKYDFDFETENKIRAEEKAVLKNANSIDEGIASKGFYEYIGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWILEKV 196          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|914615607|ref|NP_001298993.1| (larval cuticle protein LCP-22-like precursor [Papilio xuthus] >gi|389608165|dbj|BAM17694.1| cuticular protein PxutCPR1 [Papilio xuthus])

HSP 1 Score: 311.612 bits (797), Expect = 3.992e-106
Identity = 147/192 (76.56%), Postives = 172/192 (89.58%), Query Frame = 0
Query:    6 AVLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            ++   IA+C++ VAG+P EDGKWHPYKYG +GKYIPTDEGKYIHIPNPYIHI+NPY+GG+GPY+HDYEPYV  AT DRY+ V+TPP ++ PYYKDGYY+NNGIKII QKH Y+EDKYDF+FETENKIRA+E A +KNPNT DEGIAS GFYEY+GPDGF+YRVDYTADENGFRP  +R+ETPYSGKWVL+KV
Sbjct:    3 SIKYIIAICVVAVAGTPEEDGKWHPYKYGQNGKYIPTDEGKYIHIPNPYIHIDNPYNGGFGPYTHDYEPYVSAATEDRYRLVMTPPKDI-PYYKDGYYKNNGIKIISQKHVYDEDKYDFNFETENKIRAKENAILKNPNTIDEGIASSGFYEYLGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWVLEKV 193          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|914097910|ref|NP_001298451.1| (larval cuticle protein LCP-22-like precursor [Papilio polytes] >gi|389610917|dbj|BAM19069.1| cuticular protein PpolCPR1 [Papilio polytes])

HSP 1 Score: 311.227 bits (796), Expect = 6.831e-106
Identity = 146/192 (76.04%), Postives = 173/192 (90.10%), Query Frame = 0
Query:    6 AVLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            ++   IA+C++ VAG+P EDGKWHPYK+G++GKYIPTDEGKYIHIPNPYIHI+NPY+GG+GPY+HDYEPYV  AT DRY+ V+TPP ++ PYYKDGYY+NNGIKII QKH Y+EDKYDF+FETENKIRA+E A +KNPNT DEGIAS GFYEY+GPDGF+YRVDYTADENGFRP  +R+ETPYSGKWVL+KV
Sbjct:    3 SIKYLIAICVVAVAGTPEEDGKWHPYKFGNNGKYIPTDEGKYIHIPNPYIHIDNPYNGGFGPYTHDYEPYVSAATEDRYRLVMTPPKDI-PYYKDGYYKNNGIKIISQKHVYDEDKYDFNFETENKIRAKENAILKNPNTLDEGIASTGFYEYLGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWVLEKV 193          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|943960737|ref|XP_014362900.1| (PREDICTED: larval cuticle protein LCP-22-like [Papilio machaon])

HSP 1 Score: 309.301 bits (791), Expect = 3.861e-105
Identity = 146/192 (76.04%), Postives = 171/192 (89.06%), Query Frame = 0
Query:    6 AVLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            ++   IA+C++ V G+P EDGKWHPYKYG +GKYIPTDEGKYIHIPNPYIHI+NPY+GG+GPY+HDYEPYV  AT DRY+ V+TPP ++ PYYKDGYY+NNGIKII QKH Y+EDKYDF+FETENKIRA+E A +KNPNT DEGIAS GFYEY+GPDGF+YRVDYTADENGFRP  +R+ETPYSGKWVL+KV
Sbjct:    3 SIKYMIAICVVAVVGTPDEDGKWHPYKYGHNGKYIPTDEGKYIHIPNPYIHIDNPYNGGFGPYTHDYEPYVSAATEDRYRLVMTPPKDI-PYYKDGYYKNNGIKIISQKHVYDEDKYDFNFETENKIRAKENAILKNPNTIDEGIASSGFYEYLGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWVLEKV 193          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|930670884|gb|KPJ11687.1| (Larval cuticle protein LCP-30 [Papilio machaon])

HSP 1 Score: 308.145 bits (788), Expect = 9.695e-105
Identity = 146/188 (77.66%), Postives = 169/188 (89.89%), Query Frame = 0
Query:   10 TIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
             IA+C++ V G+P EDGKWHPYKYG +GKYIPTDEGKYIHIPNPYIHI+NPY+GG+GPY+HDYEPYV  AT DRY+ V+TPP ++ PYYKDGYY+NNGIKII QKH Y+EDKYDF+FETENKIRA+E A +KNPNT DEGIAS GFYEY+GPDGF+YRVDYTADENGFRP  +R+ETPYSGKWVL+KV
Sbjct:    1 MIAICVVAVVGTPDEDGKWHPYKYGHNGKYIPTDEGKYIHIPNPYIHIDNPYNGGFGPYTHDYEPYVSAATEDRYRLVMTPPKDI-PYYKDGYYKNNGIKIISQKHVYDEDKYDFNFETENKIRAKENAILKNPNTIDEGIASSGFYEYLGPDGFMYRVDYTADENGFRPKVKRLETPYSGKWVLEKV 187          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|913326527|ref|XP_013194677.1| (PREDICTED: larval cuticle protein LCP-30-like [Amyelois transitella])

HSP 1 Score: 293.893 bits (751), Expect = 4.858e-99
Identity = 152/195 (77.95%), Postives = 169/195 (86.67%), Query Frame = 0
Query:    6 AVLCTIAVCILTVAGSPL--EDGKWHPYKYGDDGKYIPTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATV-DRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            +++  IA+C + V G P   EDGKWHPYKYGD GKYIPTDEGKYIHIPNPYIH +NPY        HDYEPYVGEATV D+Y++ LTPPDELLPYY+DGYYRNNGIKIIRQKHNY+EDKYDFDFETENKIRAEEKA +KNPNT DEGIASKGFYEYIGPDGF+YRV+YTADENGFRP  +R+ET YSGKWVL+KV
Sbjct:    3 SLVYVIALCAVVVVGVPRPGEDGKWHPYKYGDTGKYIPTDEGKYIHIPNPYIHDDNPY-------IHDYEPYVGEATVVDQYRYQLTPPDELLPYYQDGYYRNNGIKIIRQKHNYQEDKYDFDFETENKIRAEEKAVLKNPNTIDEGIASKGFYEYIGPDGFMYRVEYTADENGFRPKVKRLETKYSGKWVLEKV 190          
BLAST of HiSeq13747 vs. genbank:protein
Match: gi|768422220|ref|XP_011551952.1| (PREDICTED: uncharacterized protein LOC105383577 [Plutella xylostella] >gi|768428078|ref|XP_011555161.1| PREDICTED: uncharacterized protein LOC105386337 [Plutella xylostella])

HSP 1 Score: 283.878 bits (725), Expect = 4.861e-95
Identity = 137/191 (71.73%), Postives = 161/191 (84.29%), Query Frame = 0
Query:    8 LCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYI-PTDEGKYIHIPNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKDGYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGIASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKV 197
            L   A  + +V  +P  DG+W P +Y DDGKY  P DEG+YIH+PNPYIHI+NPYDGGYGPYSH Y+PY G  + D+Y+ V+ PP++  PYYK+GYYRNNGIKII+Q+HNYEEDKYDFDFETENKIRAEE+A +KNPNT DEGIAS GFYEYIGPDGF+YRVDYTADENGFRP  +R+ETPYSGKWVL+KV
Sbjct:    6 LVFAASVVSSVIAAPSNDGRWSPEQY-DDGKYRRPRDEGRYIHVPNPYIHIDNPYDGGYGPYSHLYDPYNGAESRDQYRLVMVPPNDDNPYYKEGYYRNNGIKIIKQRHNYEEDKYDFDFETENKIRAEERAVLKNPNTADEGIASSGFYEYIGPDGFMYRVDYTADENGFRPKLKRLETPYSGKWVLEKV 195          
The following BLAST results are available for this feature:
BLAST of HiSeq13747 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930655198|gb|KPI97529.1|5.288e-10876.14Larval cuticle protein LCP-30 [Papilio xuthus][more]
gi|223671103|tpd|FAA00503.1|6.804e-10878.65TPA: putative cuticle protein [Bombyx mori][more]
gi|56462130|gb|AAV91348.1|1.418e-10777.55cuticle protein 3 [Lonomia obliqua][more]
gi|114051552|ref|NP_001040112.1|3.262e-10778.65cuticular protein RR-1 motif 1 precursor [Bombyx m... [more]
gi|914615607|ref|NP_001298993.1|3.992e-10676.56larval cuticle protein LCP-22-like precursor [Papi... [more]
gi|914097910|ref|NP_001298451.1|6.831e-10676.04larval cuticle protein LCP-22-like precursor [Papi... [more]
gi|943960737|ref|XP_014362900.1|3.861e-10576.04PREDICTED: larval cuticle protein LCP-22-like [Pap... [more]
gi|930670884|gb|KPJ11687.1|9.695e-10577.66Larval cuticle protein LCP-30 [Papilio machaon][more]
gi|913326527|ref|XP_013194677.1|4.858e-9977.95PREDICTED: larval cuticle protein LCP-30-like [Amy... [more]
gi|768422220|ref|XP_011551952.1|4.861e-9571.73PREDICTED: uncharacterized protein LOC105383577 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0042302 structural constituent of cuticle
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000618Insect cuticle proteinPRINTSPR00947CUTICLEcoord: 163..174
score: 48.91
coord: 152..163
score: 36.61
coord: 120..131
score: 25.96
IPR000618Insect cuticle proteinPFAMPF00379Chitin_bind_4coord: 122..177
e-value: 2.0E-17
score: 63.0
IPR000618Insect cuticle proteinPROSITEPS00233CHIT_BIND_RR_1coord: 154..179
IPR000618Insect cuticle proteinPROSITEPS51155CHIT_BIND_RR_2coord: 119..190
score: 17.339
NoneNo IPR availablePANTHERPTHR10380:SF8CUTICULAR PROTEIN 49AB-RELATEDcoord: 103..187
NoneNo IPR availablePANTHERPTHR10380CUTICLE PROTEINcoord: 103..187
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..5
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 21..198
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..20
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 6..16
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 17..20
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.682

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13747HiSeq13747Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13747_p ID=HiSeq13747_p|Name=HiSeq13747|organism=Ostrinia scapulalis|type=polypeptide|length=198bp
MYSTEAVLCTIAVCILTVAGSPLEDGKWHPYKYGDDGKYIPTDEGKYIHI
PNPYIHINNPYDGGYGPYSHDYEPYVGEATVDRYQHVLTPPDELLPYYKD
GYYRNNGIKIIRQKHNYEEDKYDFDFETENKIRAEEKAFIKNPNTEDEGI
ASKGFYEYIGPDGFLYRVDYTADENGFRPVQRRIETPYSGKWVLKKVE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0042302structural constituent of cuticle
Vocabulary: INTERPRO
TermDefinition
IPR000618Insect_cuticle