HiSeq13748_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13748
Unique NameHiSeq13748_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length239
Homology
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|357607642|gb|EHJ65619.1| (hypothetical protein KGM_10109 [Danaus plexippus])

HSP 1 Score: 248.054 bits (632), Expect = 6.901e-80
Identity = 111/190 (58.42%), Postives = 150/190 (78.95%), Query Frame = 0
Query:   49 LFISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVL 238
            L +SVYYES CPDSKAFIL QL+PA +LL DH+ +  VPFGKA+SIN G GGFQCQHGPSECLGN+VQ C+L  M ++ D  K+ YVACE +T + ++G   CV+KAN+  +L+ +C+  G+GT LQL++EYLT LV+ KF+PTVTI+G+++QQ QD +QVDL+GTLCS+LK    C+++YN MA+R ++
Sbjct:   25 LLLSVYYESNCPDSKAFILNQLQPAFQLLHDHMTIKFVPFGKAKSINFGDGGFQCQHGPSECLGNIVQDCSLHYMNEQPDKDKLTYVACEIKTRSASQGRFDCVEKANLPTNLIDECIFHGKGTSLQLESEYLTSLVNHKFIPTVTINGVYDQQFQDDAQVDLIGTLCSLLKGVQPCSQYYNYMALRNLM 214          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|913330366|ref|XP_013196703.1| (PREDICTED: GILT-like protein C02D5.2 [Amyelois transitella])

HSP 1 Score: 239.965 bits (611), Expect = 7.129e-77
Identity = 109/183 (59.56%), Postives = 142/183 (77.60%), Query Frame = 0
Query:   49 LFISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNS 231
            L ++V YES+CPDS++F+L QL+PAM+LL + I L LVPFGKARS N GYG F+CQHGPSECLGNVVQ CAL  M DR D++K +YVACE  T AGA+G L CVQ AN++   V  C++SGRG +LQL++E LT + SP+F+PTV I+GIFNQ++QD SQV+L+ TLC +L++   C  + NS
Sbjct:   23 LSMTVLYESKCPDSRSFVLWQLKPAMQLLRNRIKLQLVPFGKARSTNTGYG-FECQHGPSECLGNVVQDCALSLMYDRDDSEKTEYVACEMSTLAGARGSLECVQNANLAGAAVNQCISSGRGRQLQLESERLTNMYSPRFIPTVVINGIFNQRVQDMSQVNLIDTLCRILQQPSECRSYKNS 204          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|909562043|ref|XP_013136178.1| (PREDICTED: GILT-like protein C02D5.2 [Papilio polytes])

HSP 1 Score: 239.195 bits (609), Expect = 2.275e-76
Identity = 116/227 (51.10%), Postives = 151/227 (66.52%), Query Frame = 0
Query:   12 VIFYALYLIQPYWILVISLAFAYSLYVQLTMXXFDFWLFISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVL 238
            +IF +L+L       V  L+F Y    +L          ++VYYES+CPDSK FIL+QL+PA++LL  +I L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M D  D Q+V YV CE  +  GA+G L CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVTIDG+FNQ  QDS+  DL+GTLC+ L+E   CAR+YN+ A  Y+ 
Sbjct:    4 IIFISLFLCA-----VTQLSFGYVPQKRL----------LTVYYESKCPDSKKFILDQLQPAIELLHRYIKLKLIPFGKSRSINYGDDGFECQHGPEECLGNIVQECALRHMRDHNDVQRVTYVVCEMASTFGARGSLYCVKHAGLSVSAVEGCVLAGEGVALQLDSEYHTNNLKPKFIPTVTIDGVFNQDFQDSAMTDLIGTLCATLREAAPCARYYNNRAWEYIF 215          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|910338392|ref|XP_013172798.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Papilio xuthus])

HSP 1 Score: 232.261 bits (591), Expect = 1.049e-73
Identity = 102/190 (53.68%), Postives = 137/190 (72.11%), Query Frame = 0
Query:   50 FISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF 239
             ++VYYES+CPDSK F+LEQL+PA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA   L CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVT+DG+FNQ  QD++  DL+GTLC+ L+E   CAR+YN+ A  Y+ +
Sbjct:   29 LLTVYYESKCPDSKKFVLEQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNIVQECALRHMRGHSDIQRVTYVVCEMASESGAHASLGCVKHAGLSVSDVEGCVLAGEGVALQLDSEYHTDKLKPKFIPTVTLDGVFNQDFQDAAMTDLIGTLCATLREAAPCARYYNNRAWEYIFY 218          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|943977320|ref|XP_014369727.1| (PREDICTED: uncharacterized protein LOC106719799 [Papilio machaon] >gi|930665433|gb|KPJ06562.1| Gamma-interferon-inducible lysosomal thiol reductase [Papilio machaon])

HSP 1 Score: 233.032 bits (593), Expect = 1.259e-70
Identity = 102/190 (53.68%), Postives = 140/190 (73.68%), Query Frame = 0
Query:   50 FISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF 239
             ++VYYES+CPDSK F+L+QL+PA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA+G L+CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVTIDG+F+Q  QD++  DL+GTLC+ L+E   CAR+YN+ A  Y+ +
Sbjct:  289 LLTVYYESKCPDSKKFVLDQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNMVQECALRHMRGHSDVQRVTYVVCEMASESGARGSLACVKHAGLSVSDVERCVLAGEGVALQLDSEYHTDKLKPKFIPTVTIDGVFSQDFQDAAMTDLIGTLCATLREAAPCARYYNNRAWEYIFY 478          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|930650265|gb|KPI92611.1| (GILT-like protein C02D5.2 [Papilio xuthus])

HSP 1 Score: 232.261 bits (591), Expect = 2.170e-70
Identity = 102/190 (53.68%), Postives = 137/190 (72.11%), Query Frame = 0
Query:   50 FISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF 239
             ++VYYES+CPDSK F+LEQL+PA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA   L CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVT+DG+FNQ  QD++  DL+GTLC+ L+E   CAR+YN+ A  Y+ +
Sbjct:  288 LLTVYYESKCPDSKKFVLEQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNIVQECALRHMRGHSDIQRVTYVVCEMASESGAHASLGCVKHAGLSVSDVEGCVLAGEGVALQLDSEYHTDKLKPKFIPTVTLDGVFNQDFQDAAMTDLIGTLCATLREAAPCARYYNNRAWEYIFY 477          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|512914776|ref|XP_004928226.1| (PREDICTED: GILT-like protein F37H8.5 [Bombyx mori] >gi|512914780|ref|XP_004928227.1| PREDICTED: GILT-like protein F37H8.5 [Bombyx mori])

HSP 1 Score: 211.846 bits (538), Expect = 8.009e-66
Identity = 94/181 (51.93%), Postives = 129/181 (71.27%), Query Frame = 0
Query:   51 ISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNS 231
            +SV+YES C DSK FILEQL P +  L D+I L L+PFGKA SIN G  GF+CQHGP EC GN++Q C L++M   +D  KV+Y+ACE ET A  +GD+ C+ K+NV  D VR+C+  G GT LQLD+E LT+LV+PKF+PT+ +DG+F+Q  Q+ +  DL+GT+C  L+    C  ++ +
Sbjct:   26 LSVFYESACSDSKHFILEQLHPTIHKLEDYIDLQLIPFGKASSINNGGDGFECQHGPPECFGNLIQDCTLNEMKSYSDVHKVEYLACEMETMASTRGDIQCIVKSNVPHDPVRECVYLGPGTLLQLDSERLTKLVNPKFIPTIVLDGVFDQATQNKAFNDLMGTICDRLRNVKPCKEYFRN 206          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|1059388952|ref|XP_017769657.1| (PREDICTED: GILT-like protein F37H8.5 [Nicrophorus vespilloides])

HSP 1 Score: 154.066 bits (388), Expect = 3.391e-43
Identity = 76/177 (42.94%), Postives = 112/177 (63.28%), Query Frame = 0
Query:   49 LFISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVAC---EFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKET 222
            L I VYYES CPDS  FI +QL P+   +S+++ +  +PFGK+ S+  G   F+CQHGP EC GN +QSCALD + D+T  ++V++V C   E+  ++       C++ A +  + V++C  S +G ELQL AE  T  +SPKFVPTV  + +F+Q++Q  S  D  GT C ++KE 
Sbjct:   24 LKIGVYYESLCPDSLRFITKQLNPSWSDVSEYVDITFIPFGKSESVKDG-EYFRCQHGPEECKGNRIQSCALDALTDQT--KEVEFVNCFMTEYNKYSDKDFGEVCIENAGLKVEDVKNCFDSDKGKELQLQAEKDTIAISPKFVPTVVYNEVFDQKLQQDSMTDFKGTACKLIKEN 197          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|91081129|ref|XP_975539.1| (PREDICTED: GILT-like protein F37H8.5 [Tribolium castaneum] >gi|270005287|gb|EFA01735.1| GILT-like protein F37H8.5 [Tribolium castaneum])

HSP 1 Score: 149.828 bits (377), Expect = 2.128e-41
Identity = 80/179 (44.69%), Postives = 112/179 (62.57%), Query Frame = 0
Query:   49 LFISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFA-GAKGD----LSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKET 222
            L + V YES CPDS  FI +QL P  K L+ ++ L L PFGK+ S++ G   F CQHGP EC GN +QSC L+ + D+T   +V+YV C   TF  G K D     +C +   +  + +  C A+  GT+LQL AE  T  V+PKFVPT+  +G+F+QQ+QD+S VD  G +C++L +T
Sbjct:   24 LHVEVLYESLCPDSLNFITQQLHPVFKELAPYVDLKLTPFGKSASLDNGLQ-FVCQHGPKECKGNRIQSCVLNALPDQTA--QVEYVNCFMTTFKKGQKNDEEFGQACAEAVGLEFNQISQCYATETGTKLQLLAEQSTVKVTPKFVPTILYNGVFDQQLQDNSLVDFRGVVCNILAQT 199          
BLAST of HiSeq13748 vs. genbank:protein
Match: gi|1098615557|ref|XP_018788050.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Bactrocera latifrons] >gi|880826289|gb|JAI22907.1| Gamma-interferon-inducible lysosomal thiol reductase [Bactrocera latifrons])

HSP 1 Score: 145.206 bits (365), Expect = 1.205e-39
Identity = 80/177 (45.20%), Postives = 111/177 (62.71%), Query Frame = 0
Query:   49 LFISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLS-CVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPI 224
            L +++ YES CPDS  F+  QL PA   L  ++ + LVPFGK+RS+N G   F CQHGP+EC GN +QSC L+Q    T  Q+V +  C+    A  K ++  C     +S D V  C+ +  GT+LQL AE +T   SP FVPT+  DG+FNQQ+QD+SQ D  GT+C++L++  I
Sbjct:   35 LDVTILYESLCPDSIRFMGRQLAPAYGNLKQNLNVNLVPFGKSRSVNHG-NEFYCQHGPAECAGNRLQSCVLNQ--PSTQDQRVRFAICQM--LANDKQNVEECTDLVGLSSD-VDGCVKTNVGTQLQLLAEQVTNQYSPSFVPTIIYDGVFNQQLQDASQYDFRGTVCALLQKRGI 205          
The following BLAST results are available for this feature:
BLAST of HiSeq13748 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357607642|gb|EHJ65619.1|6.901e-8058.42hypothetical protein KGM_10109 [Danaus plexippus][more]
gi|913330366|ref|XP_013196703.1|7.129e-7759.56PREDICTED: GILT-like protein C02D5.2 [Amyelois tra... [more]
gi|909562043|ref|XP_013136178.1|2.275e-7651.10PREDICTED: GILT-like protein C02D5.2 [Papilio poly... [more]
gi|910338392|ref|XP_013172798.1|1.049e-7353.68PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|943977320|ref|XP_014369727.1|1.259e-7053.68PREDICTED: uncharacterized protein LOC106719799 [P... [more]
gi|930650265|gb|KPI92611.1|2.170e-7053.68GILT-like protein C02D5.2 [Papilio xuthus][more]
gi|512914776|ref|XP_004928226.1|8.009e-6651.93PREDICTED: GILT-like protein F37H8.5 [Bombyx mori]... [more]
gi|1059388952|ref|XP_017769657.1|3.391e-4342.94PREDICTED: GILT-like protein F37H8.5 [Nicrophorus ... [more]
gi|91081129|ref|XP_975539.1|2.128e-4144.69PREDICTED: GILT-like protein F37H8.5 [Tribolium ca... [more]
gi|1098615557|ref|XP_018788050.1|1.205e-3945.20PREDICTED: gamma-interferon-inducible lysosomal th... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPFAMPF03227GILTcoord: 51..156
e-value: 1.7E-23
score: 82.4
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPANTHERPTHR13234GAMMA-INTERFERON INDUCIBLE LYSOSOMAL THIOL REDUCTASE (GILT)coord: 49..238
NoneNo IPR availablePANTHERPTHR13234:SF13SUBFAMILY NOT NAMEDcoord: 49..238
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..4
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 56..239
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 31..55
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 5..25
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 26..30
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 32..54

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13748HiSeq13748Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13748_p ID=HiSeq13748_p|Name=HiSeq13748|organism=Ostrinia scapulalis|type=polypeptide|length=239bp
MEILVFLVVIMVIFYALYLIQPYWILVISLAFAYSLYVQLTMXXFDFWLF
ISVYYESRCPDSKAFILEQLRPAMKLLSDHIMLMLVPFGKARSINQGYGG
FQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLS
CVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFN
QQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR004911Interferon-induced_GILT