HiSeq13749_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13749
Unique NameHiSeq13749_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length216
Homology
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|909562043|ref|XP_013136178.1| (PREDICTED: GILT-like protein C02D5.2 [Papilio polytes])

HSP 1 Score: 249.595 bits (636), Expect = 7.357e-81
Identity = 114/211 (54.03%), Postives = 149/211 (70.62%), Query Frame = 0
Query:    5 FLFVFVVFVADGFATGYTPQKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVL 215
            F+ +F+  V    + GY PQK  ++VYYES+CP+SK F+L+QLQPA++LL  +I L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M D  D Q+V YV CE  +  GA+G L CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVTIDG+FNQ  QDS+  DL+GTLC+ L+E   CAR+YN+ A  Y+ 
Sbjct:    6 FISLFLCAVTQ-LSFGYVPQKRLLTVYYESKCPDSKKFILDQLQPAIELLHRYIKLKLIPFGKSRSINYGDDGFECQHGPEECLGNIVQECALRHMRDHNDVQRVTYVVCEMASTFGARGSLYCVKHAGLSVSAVEGCVLAGEGVALQLDSEYHTNNLKPKFIPTVTIDGVFNQDFQDSAMTDLIGTLCATLREAAPCARYYNNRAWEYIF 215          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|913330366|ref|XP_013196703.1| (PREDICTED: GILT-like protein C02D5.2 [Amyelois transitella])

HSP 1 Score: 248.44 bits (633), Expect = 1.145e-80
Identity = 119/208 (57.21%), Postives = 153/208 (73.56%), Query Frame = 0
Query:    1 MFKKFLFVFVVFVADGFATGYTPQKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNS 208
            M  K LF+FV+    G   G    KL ++V YES+CP+S++FVL QL+PAM+LL N I L LVPFGKARS N GYG F+CQHGPSECLGNVVQ CAL  M DR D++K +YVACE  T AGA+G L CVQ AN++   V  C++SGRG +LQL++E LT + SP+F+PTV I+GIFNQ++QD SQV+L+ TLC +L++   C  + NS
Sbjct:    1 MLVKVLFMFVL---AGIGRGDGSLKLSMTVLYESKCPDSRSFVLWQLKPAMQLLRNRIKLQLVPFGKARSTNTGYG-FECQHGPSECLGNVVQDCALSLMYDRDDSEKTEYVACEMSTLAGARGSLECVQNANLAGAAVNQCISSGRGRQLQLESERLTNMYSPRFIPTVVINGIFNQRVQDMSQVNLIDTLCRILQQPSECRSYKNS 204          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|357607642|gb|EHJ65619.1| (hypothetical protein KGM_10109 [Danaus plexippus])

HSP 1 Score: 248.054 bits (632), Expect = 2.951e-80
Identity = 111/192 (57.81%), Postives = 152/192 (79.17%), Query Frame = 0
Query:   24 QKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVL 215
            QKL +SVYYES CP+SKAF+L QLQPA +LL +H+ +  VPFGKA+SIN G GGFQCQHGPSECLGN+VQ C+L  M ++ D  K+ YVACE +T + ++G   CV+KAN+  +L+ +C+  G+GT LQL++EYLT LV+ KF+PTVTI+G+++QQ QD +QVDL+GTLCS+LK    C+++YN MA+R ++
Sbjct:   23 QKLLLSVYYESNCPDSKAFILNQLQPAFQLLHDHMTIKFVPFGKAKSINFGDGGFQCQHGPSECLGNIVQDCSLHYMNEQPDKDKLTYVACEIKTRSASQGRFDCVEKANLPTNLIDECIFHGKGTSLQLESEYLTSLVNHKFIPTVTINGVYDQQFQDDAQVDLIGTLCSLLKGVQPCSQYYNYMALRNLM 214          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|910338392|ref|XP_013172798.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Papilio xuthus])

HSP 1 Score: 248.054 bits (632), Expect = 3.015e-80
Identity = 112/214 (52.34%), Postives = 150/214 (70.09%), Query Frame = 0
Query:    4 KFLFVFVVFVAD-GFATGYTPQKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF 216
             F  +F++F A    + GY PQK  ++VYYES+CP+SK FVLEQLQPA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA   L CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVT+DG+FNQ  QD++  DL+GTLC+ L+E   CAR+YN+ A  Y+ +
Sbjct:    5 NFFQIFMLFCAGIHLSVGYVPQKHLLTVYYESKCPDSKKFVLEQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNIVQECALRHMRGHSDIQRVTYVVCEMASESGAHASLGCVKHAGLSVSDVEGCVLAGEGVALQLDSEYHTDKLKPKFIPTVTLDGVFNQDFQDAAMTDLIGTLCATLREAAPCARYYNNRAWEYIFY 218          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|943977320|ref|XP_014369727.1| (PREDICTED: uncharacterized protein LOC106719799 [Papilio machaon] >gi|930665433|gb|KPJ06562.1| Gamma-interferon-inducible lysosomal thiol reductase [Papilio machaon])

HSP 1 Score: 235.728 bits (600), Expect = 4.212e-72
Identity = 103/193 (53.37%), Postives = 142/193 (73.58%), Query Frame = 0
Query:   24 QKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF 216
            ++  ++VYYES+CP+SK FVL+QLQPA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA+G L+CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVTIDG+F+Q  QD++  DL+GTLC+ L+E   CAR+YN+ A  Y+ +
Sbjct:  286 EEHLLTVYYESKCPDSKKFVLDQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNMVQECALRHMRGHSDVQRVTYVVCEMASESGARGSLACVKHAGLSVSDVERCVLAGEGVALQLDSEYHTDKLKPKFIPTVTIDGVFSQDFQDAAMTDLIGTLCATLREAAPCARYYNNRAWEYIFY 478          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|930650265|gb|KPI92611.1| (GILT-like protein C02D5.2 [Papilio xuthus])

HSP 1 Score: 234.958 bits (598), Expect = 8.911e-72
Identity = 103/190 (54.21%), Postives = 137/190 (72.11%), Query Frame = 0
Query:   27 FISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNSMAMRYVLF 216
             ++VYYES+CP+SK FVLEQLQPA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA   L CV+ A +S   V  C+ +G G  LQLD+EY T  + PKF+PTVT+DG+FNQ  QD++  DL+GTLC+ L+E   CAR+YN+ A  Y+ +
Sbjct:  288 LLTVYYESKCPDSKKFVLEQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNIVQECALRHMRGHSDIQRVTYVVCEMASESGAHASLGCVKHAGLSVSDVEGCVLAGEGVALQLDSEYHTDKLKPKFIPTVTLDGVFNQDFQDAAMTDLIGTLCATLREAAPCARYYNNRAWEYIFY 477          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|512914776|ref|XP_004928226.1| (PREDICTED: GILT-like protein F37H8.5 [Bombyx mori] >gi|512914780|ref|XP_004928227.1| PREDICTED: GILT-like protein F37H8.5 [Bombyx mori])

HSP 1 Score: 208.379 bits (529), Expect = 8.529e-65
Identity = 97/207 (46.86%), Postives = 141/207 (68.12%), Query Frame = 0
Query:    3 KKFLFVFVVFVADGFATGYT-PQKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPICARHYNS 208
            K F+ ++V+     F  G    +K+ +SV+YES C +SK F+LEQL P +  L ++I L L+PFGKA SIN G  GF+CQHGP EC GN++Q C L++M   +D  KV+Y+ACE ET A  +GD+ C+ K+NV  D VR+C+  G GT LQLD+E LT+LV+PKF+PT+ +DG+F+Q  Q+ +  DL+GT+C  L+    C  ++ +
Sbjct:    2 KFFVNIYVILAV--FCIGVDLKRKVQLSVFYESACSDSKHFILEQLHPTIHKLEDYIDLQLIPFGKASSINNGGDGFECQHGPPECFGNLIQDCTLNEMKSYSDVHKVEYLACEMETMASTRGDIQCIVKSNVPHDPVRECVYLGPGTLLQLDSERLTKLVNPKFIPTIVLDGVFDQATQNKAFNDLMGTICDRLRNVKPCKEYFRN 206          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|1059388952|ref|XP_017769657.1| (PREDICTED: GILT-like protein F37H8.5 [Nicrophorus vespilloides])

HSP 1 Score: 153.295 bits (386), Expect = 3.258e-43
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 0
Query:   24 QKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVAC---EFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKET 199
            +KL I VYYES CP+S  F+ +QL P+   +S ++ +  +PFGK+ S+  G   F+CQHGP EC GN +QSCALD + D+T  ++V++V C   E+  ++       C++ A +  + V++C  S +G ELQL AE  T  +SPKFVPTV  + +F+Q++Q  S  D  GT C ++KE 
Sbjct:   22 KKLKIGVYYESLCPDSLRFITKQLNPSWSDVSEYVDITFIPFGKSESVKDG-EYFRCQHGPEECKGNRIQSCALDALTDQT--KEVEFVNCFMTEYNKYSDKDFGEVCIENAGLKVEDVKNCFDSDKGKELQLQAEKDTIAISPKFVPTVVYNEVFDQKLQQDSMTDFKGTACKLIKEN 197          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|751460473|ref|XP_011185002.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Bactrocera cucurbitae] >gi|727841438|gb|JAD03638.1| Gamma-interferon-inducible lysosomal thiol reductase [Bactrocera cucurbitae])

HSP 1 Score: 152.91 bits (385), Expect = 5.189e-43
Identity = 86/202 (42.57%), Postives = 121/202 (59.90%), Query Frame = 0
Query:    1 MFKKFLFVFVVFVADGFATGYTPQKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLS-CVQKANVSPDLVRDCMASGRGTELQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETPI 201
            +F    FVFVV           P KL +++ YES CP+S  F+  QL PA   L  ++ + LVPFGK+RS+N G   F CQHGP+EC GN +QSC L+Q  + T  Q+V +  C+    A  K ++  C     +S D V DC+ +  GT+LQL AE +T   +P FVPT+  DG+FNQQ+QD+S  D  GT+C++L++  I
Sbjct:   10 VFVLLQFVFVVLTGAQGGQSVAPNKLDVTILYESLCPDSIRFMGRQLAPAYGNLKENLNINLVPFGKSRSVNLG-SEFYCQHGPAECAGNRLQSCVLNQ--ESTQNQRVRFAICQM--LAKDKQNVEDCTDLVGLSSD-VDDCVNTNVGTQLQLLAEQVTNQYTPSFVPTIIYDGVFNQQLQDASLYDFRGTVCALLQKRGI 205          
BLAST of HiSeq13749 vs. genbank:protein
Match: gi|943942260|ref|XP_014354697.1| (PREDICTED: GILT-like protein C02D5.2, partial [Papilio machaon])

HSP 1 Score: 149.058 bits (375), Expect = 1.310e-42
Identity = 68/125 (54.40%), Postives = 90/125 (72.00%), Query Frame = 0
Query:    4 KFLFVFVVFVAD-GFATGYTPQKLFISVYYESRCPNSKAFVLEQLQPAMKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQMLDRTDAQKVDYVACEFETFAGAKGDLS 127
             F   F++F A    + GY PQK  ++VYYES+CP+SK FVL+QLQPA++LL  ++ L L+PFGK+RSIN G  GF+CQHGP ECLGN+VQ CAL  M   +D Q+V YV CE  + +GA+G L+
Sbjct:    5 NFFQSFLIFCAGVQLSVGYLPQKHLLTVYYESKCPDSKKFVLDQLQPAIELLHRYVKLRLIPFGKSRSINYGDDGFECQHGPEECLGNMVQECALRHMRGHSDVQRVTYVVCEMASESGARGSLA 129          
The following BLAST results are available for this feature:
BLAST of HiSeq13749 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909562043|ref|XP_013136178.1|7.357e-8154.03PREDICTED: GILT-like protein C02D5.2 [Papilio poly... [more]
gi|913330366|ref|XP_013196703.1|1.145e-8057.21PREDICTED: GILT-like protein C02D5.2 [Amyelois tra... [more]
gi|357607642|gb|EHJ65619.1|2.951e-8057.81hypothetical protein KGM_10109 [Danaus plexippus][more]
gi|910338392|ref|XP_013172798.1|3.015e-8052.34PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|943977320|ref|XP_014369727.1|4.212e-7253.37PREDICTED: uncharacterized protein LOC106719799 [P... [more]
gi|930650265|gb|KPI92611.1|8.911e-7254.21GILT-like protein C02D5.2 [Papilio xuthus][more]
gi|512914776|ref|XP_004928226.1|8.529e-6546.86PREDICTED: GILT-like protein F37H8.5 [Bombyx mori]... [more]
gi|1059388952|ref|XP_017769657.1|3.258e-4341.90PREDICTED: GILT-like protein F37H8.5 [Nicrophorus ... [more]
gi|751460473|ref|XP_011185002.1|5.189e-4342.57PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|943942260|ref|XP_014354697.1|1.310e-4254.40PREDICTED: GILT-like protein C02D5.2, partial [Pap... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPFAMPF03227GILTcoord: 28..133
e-value: 1.0E-22
score: 79.9
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPANTHERPTHR13234GAMMA-INTERFERON INDUCIBLE LYSOSOMAL THIOL REDUCTASE (GILT)coord: 24..215
NoneNo IPR availablePANTHERPTHR13234:SF13SUBFAMILY NOT NAMEDcoord: 24..215
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..4
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..18
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 19..216
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 14..18
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 5..13
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.713

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13749HiSeq13749Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13749_p ID=HiSeq13749_p|Name=HiSeq13749|organism=Ostrinia scapulalis|type=polypeptide|length=216bp
MFKKFLFVFVVFVADGFATGYTPQKLFISVYYESRCPNSKAFVLEQLQPA
MKLLSNHIMLMLVPFGKARSINQGYGGFQCQHGPSECLGNVVQSCALDQM
LDRTDAQKVDYVACEFETFAGAKGDLSCVQKANVSPDLVRDCMASGRGTE
LQLDAEYLTRLVSPKFVPTVTIDGIFNQQIQDSSQVDLVGTLCSVLKETP
ICARHYNSMAMRYVLF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR004911Interferon-induced_GILT