HiSeq13753_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13753
Unique NameHiSeq13753_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length121
Homology
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|509160963|gb|JAA78602.1| (phosphomevalonate kinase [Pararge aegeria])

HSP 1 Score: 138.658 bits (348), Expect = 3.086e-39
Identity = 64/91 (70.33%), Postives = 81/91 (89.01%), Query Frame = 0
Query:   31 KPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            KPIWIVSDIRR  DI+WFKETY +L+KTIR+TAD +TRI+RGFQFK GVD+VASEC LD+Y++W+LVINNG+G  SL+EQL+ I +L+P+L
Sbjct:   99 KPIWIVSDIRRTTDIQWFKETYGELVKTIRLTADEDTRIERGFQFKCGVDDVASECGLDNYNEWNLVINNGKGKQSLEEQLSRIAELIPVL 189          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|146424700|dbj|BAF62110.1| (phosphomevalonate kinase [Bombyx mori])

HSP 1 Score: 132.109 bits (331), Expect = 1.169e-36
Identity = 62/91 (68.13%), Postives = 76/91 (83.52%), Query Frame = 0
Query:   31 KPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            KP+WIVSDIRRK DIRWFKETY D+I+T+RITAD  TR +RGFQF+ GVD+  SECDLDDY+ WD+V+NNGEG  SL+EQL+ I +L+  L
Sbjct:   96 KPVWIVSDIRRKTDIRWFKETYGDIIRTVRITADDRTRKERGFQFQVGVDDATSECDLDDYNDWDVVVNNGEGRDSLEEQLDSILKLVSNL 186          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|827554343|ref|XP_012548758.1| (PREDICTED: phosphomevalonate kinase isoform X1 [Bombyx mori])

HSP 1 Score: 132.109 bits (331), Expect = 1.454e-36
Identity = 62/91 (68.13%), Postives = 76/91 (83.52%), Query Frame = 0
Query:   31 KPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            KP+WIVSDIRRK DIRWFKETY D+I+T+RITAD  TR +RGFQF+ GVD+  SECDLDDY+ WD+V+NNGEG  SL+EQL+ I +L+  L
Sbjct:  108 KPVWIVSDIRRKTDIRWFKETYGDIIRTVRITADDRTRKERGFQFQVGVDDATSECDLDDYNDWDVVVNNGEGRDSLEEQLDSILKLVSNL 198          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|1073526215|gb|JAT80219.1| (hypothetical protein g.15701 [Pectinophora gossypiella] >gi|1073529557|gb|JAT81890.1| hypothetical protein g.15700 [Pectinophora gossypiella] >gi|1073529875|gb|JAT82049.1| hypothetical protein g.15699 [Pectinophora gossypiella] >gi|1073539213|gb|JAT86718.1| hypothetical protein g.15694 [Pectinophora gossypiella])

HSP 1 Score: 131.339 bits (329), Expect = 2.561e-36
Identity = 63/96 (65.62%), Postives = 77/96 (80.21%), Query Frame = 0
Query:   26 QDFXEKPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            Q   EKPIWIVSDIRR+ DIRWFKETYKD+I+TI+I+AD ETR +RGF+FK GVD+  SECDLDDY +WDL+++NG+   SL+EQL  I  LL  L
Sbjct:   91 QSAVEKPIWIVSDIRRRTDIRWFKETYKDIIRTIQISADEETRRQRGFEFKSGVDDSISECDLDDYTEWDLIVDNGKQRQSLEEQLGSILGLLSHL 186          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|357623274|gb|EHJ74499.1| (phosphomevalonate kinase [Danaus plexippus])

HSP 1 Score: 129.413 bits (324), Expect = 1.299e-35
Identity = 60/98 (61.22%), Postives = 80/98 (81.63%), Query Frame = 0
Query:   26 QDFXEKPIWIVSDIRRKNDIRWFKETYKDL--IKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            Q+  +KP+WIVSDIRRK DI+WFKE+Y +   +KTIR+TADLETR +RG++F  G+D+ ASECDLDD+++WDLVINNG+   +L++QLN I  LLP L
Sbjct:   91 QNAADKPVWIVSDIRRKTDIKWFKESYGECSSLKTIRLTADLETRKQRGYKFASGIDDAASECDLDDFNEWDLVINNGKERDTLEKQLNSIMTLLPTL 188          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|914576581|gb|KOB78431.1| (Phosphomevalonate kinase [Operophtera brumata])

HSP 1 Score: 127.487 bits (319), Expect = 5.233e-35
Identity = 62/96 (64.58%), Postives = 76/96 (79.17%), Query Frame = 0
Query:   26 QDFXEKPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            Q+  + PIWIVSD+RRK DIRWFKETY DLI+TIRI+AD +TRI RG+ F+ GVD+V SECDLDDY +WDL I+NG+G+  L+EQL  I  LL  L
Sbjct:   78 QNARKAPIWIVSDVRRKTDIRWFKETYIDLIRTIRISADDDTRIFRGYVFRAGVDDVMSECDLDDYTEWDLAISNGQGSPLLEEQLGSILGLLAHL 173          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|114050987|ref|NP_001040145.1| (phosphomevalonate kinase [Bombyx mori] >gi|87248203|gb|ABD36154.1| phosphomevalonate kinase [Bombyx mori])

HSP 1 Score: 125.176 bits (313), Expect = 6.372e-34
Identity = 60/91 (65.93%), Postives = 74/91 (81.32%), Query Frame = 0
Query:   31 KPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            KP+WIVSDIRRK DIRWFKETY D+I+T+RITAD  TR +RGFQF+ GVD+  SECDLDDY+  D+V+NNGEG  SL+E L+ I +L+  L
Sbjct:   96 KPVWIVSDIRRKTDIRWFKETYGDIIRTVRITADDRTRKERGFQFQVGVDDATSECDLDDYNDGDVVVNNGEGRDSLEEPLDSILKLVSNL 186          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|913306492|ref|XP_013183683.1| (PREDICTED: phosphomevalonate kinase [Amyelois transitella])

HSP 1 Score: 124.405 bits (311), Expect = 1.074e-33
Identity = 62/96 (64.58%), Postives = 72/96 (75.00%), Query Frame = 0
Query:   26 QDFXEKPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLLPIL 121
            Q+  ++PIWIVSDIRRK DIRWFKETY D+I+TIRI AD  TR+ RG+QF+ GVD+  SECDLDDY  WDL+INNG     LQEQL  I  LL  L
Sbjct:   91 QNAADRPIWIVSDIRRKTDIRWFKETYGDIIRTIRIEADETTRVLRGYQFQPGVDDFPSECDLDDYYYWDLLINNGRERQQLQEQLASILGLLSHL 186          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|943948819|ref|XP_014357458.1| (PREDICTED: phosphomevalonate kinase [Papilio machaon] >gi|930675501|gb|KPJ15759.1| Phosphomevalonate kinase [Papilio machaon])

HSP 1 Score: 124.405 bits (311), Expect = 1.409e-33
Identity = 58/93 (62.37%), Postives = 75/93 (80.65%), Query Frame = 0
Query:   26 QDFXEKPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLL 118
            Q+  +KP+WIVSDIRRK DI+WFKE Y D+I+ IRITAD +TR  RG+ F+ GVD+VASECDLDDY+ WDL+INNG+   SL+EQ++ I  L+
Sbjct:   90 QNAVDKPVWIVSDIRRKTDIQWFKENYSDVIRNIRITADDDTRKARGYNFQLGVDDVASECDLDDYNDWDLIINNGKNGQSLEEQISAILTLI 182          
BLAST of HiSeq13753 vs. genbank:protein
Match: gi|910332636|ref|XP_013169678.1| (PREDICTED: phosphomevalonate kinase [Papilio xuthus])

HSP 1 Score: 120.168 bits (300), Expect = 6.572e-32
Identity = 56/89 (62.92%), Postives = 71/89 (79.78%), Query Frame = 0
Query:   30 EKPIWIVSDIRRKNDIRWFKETYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINNGEGNVSLQEQLNCIKQLL 118
            ++P+WIVSDIRRK DI+WFKE Y D I+ IRITAD +TR  RG+ F+ GVD+VASECDLDDY+ WDLVINN +   SL+EQ++ I  L+
Sbjct:   94 DRPVWIVSDIRRKTDIQWFKENYGDAIRKIRITADDDTRKARGYNFQLGVDDVASECDLDDYNDWDLVINNSKNGQSLEEQISAISTLI 182          
The following BLAST results are available for this feature:
BLAST of HiSeq13753 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|509160963|gb|JAA78602.1|3.086e-3970.33phosphomevalonate kinase [Pararge aegeria][more]
gi|146424700|dbj|BAF62110.1|1.169e-3668.13phosphomevalonate kinase [Bombyx mori][more]
gi|827554343|ref|XP_012548758.1|1.454e-3668.13PREDICTED: phosphomevalonate kinase isoform X1 [Bo... [more]
gi|1073526215|gb|JAT80219.1|2.561e-3665.63hypothetical protein g.15701 [Pectinophora gossypi... [more]
gi|357623274|gb|EHJ74499.1|1.299e-3561.22phosphomevalonate kinase [Danaus plexippus][more]
gi|914576581|gb|KOB78431.1|5.233e-3564.58Phosphomevalonate kinase [Operophtera brumata][more]
gi|114050987|ref|NP_001040145.1|6.372e-3465.93phosphomevalonate kinase [Bombyx mori] >gi|8724820... [more]
gi|913306492|ref|XP_013183683.1|1.074e-3364.58PREDICTED: phosphomevalonate kinase [Amyelois tran... [more]
gi|943948819|ref|XP_014357458.1|1.409e-3362.37PREDICTED: phosphomevalonate kinase [Papilio macha... [more]
gi|910332636|ref|XP_013169678.1|6.572e-3262.92PREDICTED: phosphomevalonate kinase [Papilio xuthu... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006695 cholesterol biosynthetic process
biological_process GO:0016310 phosphorylation
cellular_component GO:0005737 cytoplasm
molecular_function GO:0005488 binding
molecular_function GO:0004631 phosphomevalonate kinase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005919Higher eukaryotic phosphomevalonate kinasePFAMPF04275P-mevalo_kinasecoord: 29..55
e-value: 5.4E-8
score: 32.4
IPR005919Higher eukaryotic phosphomevalonate kinasePANTHERPTHR13101PHOSPHOMEVALONATE KINASEcoord: 24..121
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 26..113
e-value: 6.2E-5
score: 22.2
NoneNo IPR availablePANTHERPTHR13101:SF1PHOSPHOMEVALONATE KINASEcoord: 24..121

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13753HiSeq13753Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13753_p ID=HiSeq13753_p|Name=HiSeq13753|organism=Ostrinia scapulalis|type=polypeptide|length=121bp
MAPGIILLFSGKRKSGKDFLTDHLQQDFXEKPIWIVSDIRRKNDIRWFKE
TYKDLIKTIRITADLETRIKRGFQFKDGVDNVASECDLDDYDQWDLVINN
GEGNVSLQEQLNCIKQLLPIL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0016310phosphorylation
GO:0006695cholesterol biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO:0004631phosphomevalonate kinase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR005919Pmev_kin_anim