HiSeq13786_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13786
Unique NameHiSeq13786_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length253
Homology
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|509180575|gb|JAA88408.1| (Transmembrane protein 41-like protein [Pararge aegeria])

HSP 1 Score: 436.802 bits (1122), Expect = 2.044e-153
Identity = 205/251 (81.67%), Postives = 231/251 (92.03%), Query Frame = 0
Query:    3 TTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            T    K ++TS +L LV IIF+SS++ L L+Y QFP LEEHEK H+KLPWDLE+AKQLGLVLDRYKD+YFYEV+ GVF++YIFLQTFAIPGSIFLSILSGFLFPFYLAL+LVCCCSAIGASLCFFLSNLLGKKLV R+FPERAAQWSKAV KHKNNLLNY+IFLRVTPFLPNWFINM+APVIGVPL+PF LGTFIGVAPPSFVAIQAGQTLHT+TSTSDAWSWTS+ +L+ FALISL+PVLLK +L+EKF+
Sbjct:   21 TEAPRKGLSTSTALILVAIIFISSLVALGLLYKQFPKLEEHEKQHLKLPWDLEDAKQLGLVLDRYKDRYFYEVLLGVFMVYIFLQTFAIPGSIFLSILSGFLFPFYLALVLVCCCSAIGASLCFFLSNLLGKKLVRRFFPERAAQWSKAVTKHKNNLLNYMIFLRVTPFLPNWFINMSAPVIGVPLLPFALGTFIGVAPPSFVAIQAGQTLHTMTSTSDAWSWTSVTILTLFALISLVPVLLKQRLKEKFE 271          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|357624069|gb|EHJ74973.1| (hypothetical protein KGM_12190 [Danaus plexippus])

HSP 1 Score: 423.705 bits (1088), Expect = 1.561e-148
Identity = 201/245 (82.04%), Postives = 226/245 (92.24%), Query Frame = 0
Query:    9 NITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
             ++TS++L LV IIFV S+  L L+Y+QFP+LE  EK H+KLP DLE+AKQLGLVLDRYK+KYFYEV+ GVF++YIFLQTFAIPGSIFLSILSGFLFPFYLAL+LVCCCSAIGASLCFFLSNLLGK+LV ++FPERA QWSKAV KHKNNLLNYIIFLRVTPFLPNWFINM+APVIGVPL+PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ +LS FALISL+PVLLK KL+EKF+
Sbjct:    8 GLSTSRALTLVAIIFVMSLTALGLLYSQFPELEVEEKQHIKLPMDLEDAKQLGLVLDRYKEKYFYEVLLGVFMVYIFLQTFAIPGSIFLSILSGFLFPFYLALVLVCCCSAIGASLCFFLSNLLGKRLVRKFFPERAEQWSKAVTKHKNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLVPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVTILSIFALISLVPVLLKQKLKEKFE 252          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|943958321|ref|XP_014361868.1| (PREDICTED: transmembrane protein 41 homolog [Papilio machaon] >gi|930671836|gb|KPJ12530.1| Transmembrane protein 41-like [Papilio machaon])

HSP 1 Score: 423.705 bits (1088), Expect = 3.325e-148
Identity = 200/252 (79.37%), Postives = 230/252 (91.27%), Query Frame = 0
Query:    2 VTTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            + +T   +++TSK+L +V IIF +S++TL ++Y QFP LEE EK ++KLPWDLE+AK LGLVLDRYKDKYF+EV+FGVF++YIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKK+V ++FPERAAQWSKAV KH NNLLNYIIFLRVTPFLPNWFINM+APVIGVPL PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ VL+ FA +SLIPV LK+KL++KF+
Sbjct:   23 INSTNTSDLSTSKALIIVAIIFGTSLLTLGVLYRQFPQLEESEKQYLKLPWDLEDAKNLGLVLDRYKDKYFHEVLFGVFLVYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKVVRKFFPERAAQWSKAVSKHSNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLFPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVTVLTIFAFVSLIPVALKHKLKQKFE 274          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|910343358|ref|XP_013175442.1| (PREDICTED: transmembrane protein 41 homolog isoform X2 [Papilio xuthus])

HSP 1 Score: 420.239 bits (1079), Expect = 7.073e-147
Identity = 198/252 (78.57%), Postives = 229/252 (90.87%), Query Frame = 0
Query:    2 VTTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            + +T   +++TSK+L +V IIF +S++TL ++Y QFP LEE EK ++KLPWDLE+AK LGLVLDRYKDKYF+EV+ GVF++YIFLQTFAIPGSIFLSILSGFLFPFYLAL+LVCCCSAIGASLCFFLSNLLGKK+V ++FPERAAQWSKAV KH NNLLNYIIFLRVTPFLPNWFINM+APVIGVPL PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ VL+ FA +SLIPV LK+KL++KF+
Sbjct:   23 INSTNTNDLSTSKALIIVAIIFGTSLLTLGVLYRQFPQLEESEKQYLKLPWDLEDAKNLGLVLDRYKDKYFHEVLLGVFLVYIFLQTFAIPGSIFLSILSGFLFPFYLALILVCCCSAIGASLCFFLSNLLGKKVVRKFFPERAAQWSKAVSKHSNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLFPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVAVLTIFAFVSLIPVALKHKLKQKFE 274          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|910343356|ref|XP_013175441.1| (PREDICTED: transmembrane protein 41 homolog isoform X1 [Papilio xuthus] >gi|930659816|gb|KPJ01858.1| Transmembrane protein 41-like [Papilio xuthus])

HSP 1 Score: 420.239 bits (1079), Expect = 3.326e-146
Identity = 198/252 (78.57%), Postives = 229/252 (90.87%), Query Frame = 0
Query:    2 VTTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            + +T   +++TSK+L +V IIF +S++TL ++Y QFP LEE EK ++KLPWDLE+AK LGLVLDRYKDKYF+EV+ GVF++YIFLQTFAIPGSIFLSILSGFLFPFYLAL+LVCCCSAIGASLCFFLSNLLGKK+V ++FPERAAQWSKAV KH NNLLNYIIFLRVTPFLPNWFINM+APVIGVPL PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ VL+ FA +SLIPV LK+KL++KF+
Sbjct:   61 INSTNTNDLSTSKALIIVAIIFGTSLLTLGVLYRQFPQLEESEKQYLKLPWDLEDAKNLGLVLDRYKDKYFHEVLLGVFLVYIFLQTFAIPGSIFLSILSGFLFPFYLALILVCCCSAIGASLCFFLSNLLGKKVVRKFFPERAAQWSKAVSKHSNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLFPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVAVLTIFAFVSLIPVALKHKLKQKFE 312          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|909560236|ref|XP_013135201.1| (PREDICTED: transmembrane protein 41 homolog isoform X2 [Papilio polytes])

HSP 1 Score: 418.698 bits (1075), Expect = 3.542e-146
Identity = 198/252 (78.57%), Postives = 228/252 (90.48%), Query Frame = 0
Query:    2 VTTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            + +T   +++TSK+L +V IIF +S++TL ++Y QFP LE  EK ++KLPWDLE+AK LGLVLDRYKDKYF+EV+FGVF++YIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKK+V ++FP+RAAQWSKAV KH NNLLNYIIFLRVTPFLPNWFINM+APVIGVPL PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ VL+ FA +SLIPV LK+KL+ KF+
Sbjct:   23 INSTNTSDLSTSKALIIVAIIFGTSLLTLGILYRQFPQLEASEKQYLKLPWDLEDAKNLGLVLDRYKDKYFHEVLFGVFLVYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKVVRKFFPDRAAQWSKAVSKHSNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLFPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVAVLTIFAFMSLIPVALKHKLKHKFE 274          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|909560234|ref|XP_013135200.1| (PREDICTED: transmembrane protein 41 homolog isoform X1 [Papilio polytes])

HSP 1 Score: 417.927 bits (1073), Expect = 2.579e-145
Identity = 198/252 (78.57%), Postives = 228/252 (90.48%), Query Frame = 0
Query:    2 VTTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            + +T   +++TSK+L +V IIF +S++TL ++Y QFP LE  EK ++KLPWDLE+AK LGLVLDRYKDKYF+EV+FGVF++YIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKK+V ++FP+RAAQWSKAV KH NNLLNYIIFLRVTPFLPNWFINM+APVIGVPL PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ VL+ FA +SLIPV LK+KL+ KF+
Sbjct:   61 INSTNTSDLSTSKALIIVAIIFGTSLLTLGILYRQFPQLEASEKQYLKLPWDLEDAKNLGLVLDRYKDKYFHEVLFGVFLVYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKVVRKFFPDRAAQWSKAVSKHSNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLFPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVAVLTIFAFMSLIPVALKHKLKHKFE 312          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|389610355|dbj|BAM18789.1| (similar to CG8408 [Papilio xuthus])

HSP 1 Score: 406.757 bits (1044), Expect = 4.390e-142
Identity = 193/236 (81.78%), Postives = 218/236 (92.37%), Query Frame = 0
Query:   18 LVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            +V IIF +S++TL ++Y QFP LEE EK ++KLPWDLE+AK LGLVLDRYKDKYF+EV+ GVF++YIFLQTFAIPGSIFLSILSGFLFPFYLAL+LVCCCSAIGASLCFFLSNLLGKK+V ++FPERAAQWSKAV KH NNLLNYIIFLRVTPFLPNWFINM+APVIGVPL PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTS+ VL+ FA +SLIPV LK+KL++KF+
Sbjct:    1 MVAIIFGTSLLTLGVLYRQFPQLEESEKQYLKLPWDLEDAKNLGLVLDRYKDKYFHEVLLGVFLVYIFLQTFAIPGSIFLSILSGFLFPFYLALILVCCCSAIGASLCFFLSNLLGKKVVRKFFPERAAQWSKAVSKHSNNLLNYIIFLRVTPFLPNWFINMSAPVIGVPLFPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSVAVLTIFAFVSLIPVALKHKLKQKFE 236          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|913309916|ref|XP_013185567.1| (PREDICTED: transmembrane protein 41 homolog [Amyelois transitella])

HSP 1 Score: 400.593 bits (1028), Expect = 4.325e-139
Identity = 185/241 (76.76%), Postives = 222/241 (92.12%), Query Frame = 0
Query:   13 SKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            SK++ LV++IF++S+  L L+  QFP LEEHE  H++LP +LE+AKQLGLVLDRYKDKYF++V+ G+ ++Y+FLQTFAIPGSIFLSILSGFLFPFYLALLL+CCCSAIGASLCFFLS+LLGK+L+ R++P +AAQW+  V++HKNNLLNYIIFLRVTPFLPNWFIN+TAPVIGVPL+PF LGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVL+ FA++SL+PVLLK +L+EKFD
Sbjct:   31 SKAIILVVLIFIASLFALVLLSRQFPKLEEHENQHLRLPLNLEDAKQLGLVLDRYKDKYFFQVLSGLCLVYVFLQTFAIPGSIFLSILSGFLFPFYLALLLICCCSAIGASLCFFLSHLLGKRLIARFYPAQAAQWAATVKRHKNNLLNYIIFLRVTPFLPNWFINLTAPVIGVPLVPFALGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLTVFAVVSLVPVLLKKQLREKFD 271          
BLAST of HiSeq13786 vs. genbank:protein
Match: gi|1069815731|ref|XP_018331227.1| (PREDICTED: transmembrane protein 41B isoform X2 [Agrilus planipennis])

HSP 1 Score: 351.673 bits (901), Expect = 5.070e-120
Identity = 159/244 (65.16%), Postives = 207/244 (84.84%), Query Frame = 0
Query:   10 ITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKLPWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSILSGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSKAVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVAPPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQEKFD 253
            ++T  +L  V++IFV S  TL LVY  FP++   E+ H++LPW++E+AK LG+VL +YK++++  V+ GVF+ YIFLQTFAIPGS+FLSILSGFLFPFYLAL LVC CSA+GA+LCF LS LLG++L+  Y+PER A+W+  V+KH+ NLLNYIIFLRVTPFLPNWFIN+TAPVIGVPL+PF LGTF+GVAPPSFVAIQ GQTLHT+TS+   +SW+S+++L+ FA+ISLIPV +K+KL+EKF+
Sbjct:   15 LSTRSALLAVVVIFVCSFFTLLLVYANFPNVTSEERQHIRLPWNIEQAKNLGIVLSKYKEQHYVPVLTGVFLTYIFLQTFAIPGSLFLSILSGFLFPFYLALCLVCTCSAVGATLCFLLSQLLGRRLIMIYYPERVAKWAAMVDKHRTNLLNYIIFLRVTPFLPNWFINLTAPVIGVPLVPFALGTFLGVAPPSFVAIQTGQTLHTMTSSDTGFSWSSVLLLAVFAIISLIPVFIKHKLKEKFE 258          
The following BLAST results are available for this feature:
BLAST of HiSeq13786 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|509180575|gb|JAA88408.1|2.044e-15381.67Transmembrane protein 41-like protein [Pararge aeg... [more]
gi|357624069|gb|EHJ74973.1|1.561e-14882.04hypothetical protein KGM_12190 [Danaus plexippus][more]
gi|943958321|ref|XP_014361868.1|3.325e-14879.37PREDICTED: transmembrane protein 41 homolog [Papil... [more]
gi|910343358|ref|XP_013175442.1|7.073e-14778.57PREDICTED: transmembrane protein 41 homolog isofor... [more]
gi|910343356|ref|XP_013175441.1|3.326e-14678.57PREDICTED: transmembrane protein 41 homolog isofor... [more]
gi|909560236|ref|XP_013135201.1|3.542e-14678.57PREDICTED: transmembrane protein 41 homolog isofor... [more]
gi|909560234|ref|XP_013135200.1|2.579e-14578.57PREDICTED: transmembrane protein 41 homolog isofor... [more]
gi|389610355|dbj|BAM18789.1|4.390e-14281.78similar to CG8408 [Papilio xuthus][more]
gi|913309916|ref|XP_013185567.1|4.325e-13976.76PREDICTED: transmembrane protein 41 homolog [Amyel... [more]
gi|1069815731|ref|XP_018331227.1|5.070e-12065.16PREDICTED: transmembrane protein 41B isoform X2 [A... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF09335SNARE_assoccoord: 91..211
e-value: 2.8E-24
score: 85.5
NoneNo IPR availablePANTHERPTHR12677:SF15TRANSMEMBRANE PROTEIN 41Bcoord: 15..251
NoneNo IPR availablePANTHERPTHR12677UNCHARACTERIZEDcoord: 15..251
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 100..104
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 15..35
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 36..74
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 105..129
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..14
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 222..244
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 159..177
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 75..99
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 178..221
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 245..253
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 130..158
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 185..207

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13786HiSeq13786Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13786_p ID=HiSeq13786_p|Name=HiSeq13786|organism=Ostrinia scapulalis|type=polypeptide|length=253bp
MVTTTTDKNITTSKSLFLVLIIFVSSVMTLALVYTQFPDLEEHEKPHVKL
PWDLEEAKQLGLVLDRYKDKYFYEVMFGVFVIYIFLQTFAIPGSIFLSIL
SGFLFPFYLALLLVCCCSAIGASLCFFLSNLLGKKLVNRYFPERAAQWSK
AVEKHKNNLLNYIIFLRVTPFLPNWFINMTAPVIGVPLIPFTLGTFIGVA
PPSFVAIQAGQTLHTLTSTSDAWSWTSIIVLSAFALISLIPVLLKNKLQE
KFD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane