HiSeq13798_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13798
Unique NameHiSeq13798_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length434
Homology
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|357617443|gb|EHJ70794.1| (hypothetical protein KGM_19481 [Danaus plexippus])

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 355/425 (83.53%), Postives = 399/425 (93.88%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLAAD 434
            QDARFHILGFAACLRHGLIPNLLDGGRNAR+NCRDAVWWWL SIKQYC+EAP G++IL +PVSR+FPKDDSEPAPPGAADQPLHDVMQEALDVHFQGL FRER AGR IDAHM+D+GFN+QIGVDP+TGFPFGGN+ANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVA+A+ V +WLAAQHR+A+YPYPGV RRHRDG+LT+WTY+QWA+R+R SFER FWVPAAPSAAD RPDLVHRRAIYKDTHGAS+PWADYQLRCN+VVAMA+APELFDPRHAWLALD VE+LL+GPLG+KTLDP DWAYR +YDNS++S DP+VAHG+NYHQGPEW WP GFYLRARLAFAH+NG+ ++TVAAAYAALAP +AE+R+SPWRGLPEL+NAGGA+C DSCRTQAWSS+ +LE LHDLEL+RRARPL  D
Sbjct: 1235 QDARFHILGFAACLRHGLIPNLLDGGRNARFNCRDAVWWWLQSIKQYCTEAPQGYSILTDPVSRIFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLVFRERNAGRQIDAHMSDKGFNIQIGVDPETGFPFGGNEANCGTWMDKMGSSETAGTRGKPATPRDGSAVELVAMAYCVASWLAAQHRSAKYPYPGVARRHRDGSLTAWTYSQWADRIRRSFERHFWVPAAPSAADQRPDLVHRRAIYKDTHGASQPWADYQLRCNYVVAMALAPELFDPRHAWLALDNVEKLLVGPLGLKTLDPEDWAYRPNYDNSDNSSDPSVAHGFNYHQGPEWTWPLGFYLRARLAFAHDNGQFSKTVAAAYAALAPLVAEMRSSPWRGLPELSNAGGAFCKDSCRTQAWSSSCMLEVLHDLELSRRARPLPLD 1659          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|930655743|gb|KPI98071.1| (Glycogen debranching enzyme [Papilio xuthus])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 351/423 (82.98%), Postives = 385/423 (91.02%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLA 432
            Q+A+ HIL F ACLRHGLIPNLLDGGRNARYNCRDAVWWWL SIKQYC E P G A+L E V+RL+P+DD EPAPPG+ADQPLHDVMQEALDVHFQGL FRER AGRAIDAHM+D+GFNVQIG+DP+TGFPFGGNDANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVALA+SV +WLAAQHRAAR+PYPGV RRHRDG+LT+WTYAQWA+R+R +FER FWVPAAP AAD RPDLVHRRAIYKDTH A+RPWADYQLRCNF VAMAVAP++FDP+HAWLALD VERLLLGPLGVKTLDPADWAYRGDYDNSN+SDDP VAHG+NYHQGPEW+WP G+YL ARLAFA ENGK+A+TVAA YA LAP +AELR+SPWRGLPELTNAGGA+CA SCRTQAWS+ATVLEAL + E  R AR L 
Sbjct: 1274 QEAKAHILSFGACLRHGLIPNLLDGGRNARYNCRDAVWWWLQSIKQYCCEVPGGGALLAEGVARLYPRDDCEPAPPGSADQPLHDVMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNVQIGIDPETGFPFGGNDANCGTWMDKMGSSEAAGTRGKPATPRDGSAVELVALAYSVASWLAAQHRAARFPYPGVARRHRDGSLTAWTYAQWADRIRRNFERYFWVPAAPGAADLRPDLVHRRAIYKDTHAATRPWADYQLRCNFPVAMAVAPDIFDPKHAWLALDNVERLLLGPLGVKTLDPADWAYRGDYDNSNNSDDPNVAHGFNYHQGPEWVWPIGYYLMARLAFAQENGKYAKTVAATYATLAPLVAELRSSPWRGLPELTNAGGAFCAGSCRTQAWSAATVLEALREAEALRDARTLT 1696          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|910347332|ref|XP_013177598.1| (PREDICTED: LOW QUALITY PROTEIN: glycogen debranching enzyme [Papilio xuthus])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 349/420 (83.10%), Postives = 384/420 (91.43%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRAR 429
            Q+A+ HIL F ACLRHGLIPNLLDGGRNARYNCRDAVWWWL SIKQYC E P G A+L E V+RL+P+DD EPAPPG+A+QPLHDVMQEALDVHFQGL FRER AGRAIDAHM+D+GFNVQIG+DP+TGFPFGGNDANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVALA+SV +WLAAQHRAAR+PYPGV RRHRDG+LT+WTYAQWA+R+R +FER FWVPAAP AAD RPDLVHRRAIYKDTH A+RPWADYQLRCNF VAMAVAP++FDP+HAWLALD VERLLLGPLGVKTLDPADWAYRGDYDNSN+SDDP VAHG+NYHQGPEW+WP G+YL ARLAFA ENGK+A+TVAA YA LAP +AELR+SPWRGLPELTNAGGA+CA SCRTQAWS+ATVLEAL + E  R AR
Sbjct: 1167 QEAKAHILSFGACLRHGLIPNLLDGGRNARYNCRDAVWWWLQSIKQYCCEVPGGGALLAEGVARLYPRDDCEPAPPGSANQPLHDVMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNVQIGIDPETGFPFGGNDANCGTWMDKMGSSEAAGTRGKPATPRDGSAVELVALAYSVASWLAAQHRAARFPYPGVARRHRDGSLTAWTYAQWADRIRRNFERYFWVPAAPGAADLRPDLVHRRAIYKDTHAATRPWADYQLRCNFPVAMAVAPDIFDPKHAWLALDNVERLLLGPLGVKTLDPADWAYRGDYDNSNNSDDPNVAHGFNYHQGPEWVWPIGYYLMARLAFAQENGKYAKTVAATYATLAPLVAELRSSPWRGLPELTNAGGAFCAGSCRTQAWSAATVLEALREAEALRDAR 1586          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|913309261|ref|XP_013185209.1| (PREDICTED: glycogen debranching enzyme [Amyelois transitella])

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 341/423 (80.61%), Postives = 377/423 (89.13%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLA 432
            QDARFHILGFAACLRHGLIPNLLDGG  ARYNCRDAVWWWL SIK+YCS +P G  +L EPVSRLFP+DDSEPAPPGAAD PLHD+MQEALDVHFQGL FRER AGRAIDAHM+D+GFN+QIGVDP+TGFPFGGNDANCGTWMDKMGSS+ AG RGKPATPRDGSAVELV LA+SVV+WL+AQHRAARYPY GVVRRHRDG+LTSWT+ QWA+++R++FER FW+P+APSAAD RPDLVHRR +YKD+HGASRPWADYQLRCNF +AMAVAP+LFDP+ AW ALD VE+LLLGPLG+KTLDP DWAYRGDYDNSN+SDDP+VAHG+NYHQGPEW WP GFYL ARL FA   G+ ART+ A YAAL P  AE+  +PWRGLPEL NAGGAYC DSCRTQAWSSA VLE LH LE ARRARPL 
Sbjct: 1147 QDARFHILGFAACLRHGLIPNLLDGGPRARYNCRDAVWWWLQSIKEYCSMSPQGCGLLSEPVSRLFPQDDSEPAPPGAADMPLHDIMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNIQIGVDPETGFPFGGNDANCGTWMDKMGSSDIAGNRGKPATPRDGSAVELVGLAYSVVSWLSAQHRAARYPYQGVVRRHRDGSLTSWTFGQWADKIRSNFERYFWIPSAPSAADQRPDLVHRRGVYKDSHGASRPWADYQLRCNFPIAMAVAPDLFDPKRAWAALDMVEKLLLGPLGLKTLDPEDWAYRGDYDNSNNSDDPSVAHGFNYHQGPEWTWPLGFYLLARLRFAQAAGRAARTLGAVYAALGPLSAEIHGAPWRGLPELANAGGAYCRDSCRTQAWSSALVLEVLHALEAARRARPLG 1569          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|943948296|ref|XP_014357205.1| (PREDICTED: glycogen debranching enzyme [Papilio machaon])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 313/383 (81.72%), Postives = 346/383 (90.34%), Query Frame = 0
Query:   50 LHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLA 432
            L  +  YC E P G A+L E V+R++P+DD EPAPPG+ADQPLHDVMQEALDVHFQGL FRER AGRAIDAHM+D+GFNVQIG+DP+TGFPFGGNDANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVALA+SV +WLAAQHRAAR+PYPGV RRHRDG+LT+WTYAQWAER+R +FER FWV AAPSAAD RPDLVHRRAIYKDTHGA+RPWADYQLRCNF VAMA+APE+FDP+HAWLALD VERLLLGPLGVKTLDPADWAYRGDYDNSN+SDDP +AHG+NYHQGPEW+WP G+YL ARLAFA ENGK+A+TVAA YA LAP +AELR+SPWRGLPELTNAGGAYC DSCRTQAWS+ATVLEAL + E  R AR L 
Sbjct:  973 LADLTLYCCEVPGGGALLAEGVARMYPRDDCEPAPPGSADQPLHDVMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNVQIGIDPETGFPFGGNDANCGTWMDKMGSSEAAGTRGKPATPRDGSAVELVALAYSVASWLAAQHRAARFPYPGVARRHRDGSLTAWTYAQWAERIRHNFERYFWVSAAPSAADLRPDLVHRRAIYKDTHGATRPWADYQLRCNFSVAMAIAPEIFDPKHAWLALDNVERLLLGPLGVKTLDPADWAYRGDYDNSNNSDDPNIAHGFNYHQGPEWVWPIGYYLLARLAFAKENGKYAKTVAATYATLAPLVAELRSSPWRGLPELTNAGGAYCKDSCRTQAWSAATVLEALREAEALRNARTLT 1355          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|1179788182|gb|ARI45581.1| (glycogen debranching enzyme, partial [Leptinotarsa decemlineata])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 279/419 (66.59%), Postives = 336/419 (80.19%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRA 428
            Q+AR HILG+AACLRHGLIPNLLDGGRN R+NCRDAVWWWLH IK+Y +EAP G +IL + VSR+FPKDDS   PPGA DQPLHDVMQEAL+VHFQGLAFRER AG+ ID HM D+GFN QIGV P+TGF FGGN  NCGTWMDKMGSS+ AG RGKPATPRDGSAVEL+ L+ SV++WLA      +YPYPGV R H+DG +T WT+ +W+++++A+FE+ FW+ + P+  + RPDL+++R IYKD H AS+ W D+QLRCNF VAM  APELF P HAW AL   E+ LLGPLG+KTLDP DWAYRGDY+NSNDS+DP VA+G+NYHQGPEW+WP GF+LRA+L FA +NG    T+A+A   L+ H  EL+ SPWRGLPELTN  G+YC+DS RTQAWS + VLE L+D +   RA
Sbjct: 1200 QEAREHILGYAACLRHGLIPNLLDGGRNPRFNCRDAVWWWLHCIKEYVTEAPDGISILSDKVSRIFPKDDSAAQPPGAVDQPLHDVMQEALNVHFQGLAFRERNAGKQIDEHMTDQGFNNQIGVHPETGFIFGGNQWNCGTWMDKMGSSDKAGNRGKPATPRDGSAVELIGLSKSVISWLAKLDAEKKYPYPGVERTHKDGRITRWTFKEWSDKIQANFEKHFWINSKPTEGEIRPDLINKRGIYKDCHDASQEWTDFQLRCNFPVAMVAAPELFSPSHAWEALAQAEKYLLGPLGMKTLDPKDWAYRGDYNNSNDSNDPTVANGFNYHQGPEWVWPIGFFLRAKLIFAAQNGALKETLASAKLILSKHFVELQTSPWRGLPELTNTNGSYCSDSSRTQAWSMSCVLEVLYDFKKLSRA 1618          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|1133429301|ref|XP_019870586.1| (PREDICTED: LOW QUALITY PROTEIN: glycogen debranching enzyme-like [Aethina tumida])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 267/415 (64.34%), Postives = 329/415 (79.28%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLEL 424
            ++AR  ILG+AACLRHGLIPNLL GG  +RYNCRDAVWWW+H IK+YC+E P G  IL + VSRLFP DDS P P G  DQPLH+V+QEAL +HFQGLAFRER AG +IDAHM D+GFN QIG+ P+TGF FGGN+ NCGTWMDKMGSS+ AG RGKPATPRDGSAVELV L++SV +WLA  +   +YP+ GV R H++G  T+WT+ +W+E+++A+FE+ FW+  +P+  + RPDL+++R IYKD+HGAS+ WAD+QLRCNF + M VAPELF+ +HAW AL   E+ LLGPLG++TLDP DWAY G+YDNSNDSDD  VAHG NYHQGPEW+WP GF+LRA+L FA +NG    T++     L+ H  EL+ SPWRGLPELTN  GAYC  SCRTQAWS A +LE L+DL+L
Sbjct: 2185 EEARQTILGYAACLRHGLIPNLLFGGAQSRYNCRDAVWWWMHCIKEYCTEVPNGCDILNDVVSRLFPTDDSPPLPAGTVDQPLHEVIQEALTIHFQGLAFRERNAGGSIDAHMTDKGFNNQIGIHPETGFVFGGNEWNCGTWMDKMGSSDKAGNRGKPATPRDGSAVELVGLSYSVTSWLATLYEKQQYPHSGVTRTHKNGTTTTWTFKEWSEKIKANFEKYFWISGSPAKDEIRPDLINKRGIYKDSHGASQDWADFQLRCNFPITMVVAPELFNAQHAWTALQQAEKYLLGPLGMRTLDPEDWAYNGNYDNSNDSDDFKVAHGLNYHQGPEWVWPVGFFLRAKLRFAADNGALIETLSKVKVVLSRHFVELQTSPWRGLPELTNKDGAYCEGSCRTQAWSMACILEVLNDLQL 2599          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|1080067539|ref|XP_018576026.1| (PREDICTED: glycogen debranching enzyme isoform X2 [Anoplophora glabripennis])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 269/422 (63.74%), Postives = 326/422 (77.25%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPL 431
            ++AR HILG+AACLRHGLIPNLLDGGRN+R+NCRDAVWWWL+ IK+Y  EAP G  IL + VSR+FP DDS   PPGA DQPLHDVMQEAL VHFQGL FRER AGR ID HM DRGFN QIGV P+TGF FGGN  NCGTWMDKMGSS+ AG RG PATPRDGSAVEL+ L+ +V+ WL   ++  +YPY GV R H++G++T WT+ +W+++++A+FE+ FW+   P   + R DL+HRR IYKD+ GAS  WAD+QLRCNF +AM  APELF P+ AW AL   E+ LLGPLG+KTLDP DW Y G+YDNSNDS DP+VA+G+NYHQGPEW+WP GF+LRA+L FA  NG    T+A     L+ H  EL++S WRGLPELTN+ G+YC DS RTQAWS A +LE LHDL+     +P+
Sbjct: 2001 EEARQHILGYAACLRHGLIPNLLDGGRNSRFNCRDAVWWWLYCIKEYVEEAPNGDKILTDKVSRIFPTDDSPAQPPGAVDQPLHDVMQEALKVHFQGLTFRERNAGRQIDEHMTDRGFNNQIGVHPETGFVFGGNGWNCGTWMDKMGSSDKAGNRGGPATPRDGSAVELIGLSKAVITWLWKLNQNKKYPYSGVERTHKNGSVTKWTFKEWSDKIQANFEKYFWISNTPVPEEYRSDLIHRRGIYKDSFGASNVWADFQLRCNFPIAMVAAPELFTPQQAWTALRQAEKHLLGPLGMKTLDPKDWLYNGNYDNSNDSTDPSVANGFNYHQGPEWVWPVGFFLRAKLHFASLNGVLNETIADTKVVLSKHFTELQSSVWRGLPELTNSNGSYCRDSSRTQAWSMACILEVLHDLQKIESNQPV 2422          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|1080067537|ref|XP_018576025.1| (PREDICTED: glycogen debranching enzyme isoform X1 [Anoplophora glabripennis])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 269/422 (63.74%), Postives = 326/422 (77.25%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPL 431
            ++AR HILG+AACLRHGLIPNLLDGGRN+R+NCRDAVWWWL+ IK+Y  EAP G  IL + VSR+FP DDS   PPGA DQPLHDVMQEAL VHFQGL FRER AGR ID HM DRGFN QIGV P+TGF FGGN  NCGTWMDKMGSS+ AG RG PATPRDGSAVEL+ L+ +V+ WL   ++  +YPY GV R H++G++T WT+ +W+++++A+FE+ FW+   P   + R DL+HRR IYKD+ GAS  WAD+QLRCNF +AM  APELF P+ AW AL   E+ LLGPLG+KTLDP DW Y G+YDNSNDS DP+VA+G+NYHQGPEW+WP GF+LRA+L FA  NG    T+A     L+ H  EL++S WRGLPELTN+ G+YC DS RTQAWS A +LE LHDL+     +P+
Sbjct: 2007 EEARQHILGYAACLRHGLIPNLLDGGRNSRFNCRDAVWWWLYCIKEYVEEAPNGDKILTDKVSRIFPTDDSPAQPPGAVDQPLHDVMQEALKVHFQGLTFRERNAGRQIDEHMTDRGFNNQIGVHPETGFVFGGNGWNCGTWMDKMGSSDKAGNRGGPATPRDGSAVELIGLSKAVITWLWKLNQNKKYPYSGVERTHKNGSVTKWTFKEWSDKIQANFEKYFWISNTPVPEEYRSDLIHRRGIYKDSFGASNVWADFQLRCNFPIAMVAAPELFTPQQAWTALRQAEKHLLGPLGMKTLDPKDWLYNGNYDNSNDSTDPSVANGFNYHQGPEWVWPVGFFLRAKLHFASLNGVLNETIADTKVVLSKHFTELQSSVWRGLPELTNSNGSYCRDSSRTQAWSMACILEVLHDLQKIESNQPV 2428          
BLAST of HiSeq13798 vs. genbank:protein
Match: gi|1069792087|ref|XP_018321143.1| (PREDICTED: glycogen debranching enzyme [Agrilus planipennis])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 275/422 (65.17%), Postives = 323/422 (76.54%), Query Frame = 0
Query:   10 QDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPL 431
            ++ARFHILG+AACLRHGLIPNLLD G N RYNCRDAVWWWLH IK Y  E   G  IL + VSRLFP D S    PG ADQPLH VMQEAL VHFQGL FRER AGR IDAHM+DRGFN QIGV P+TGF FGGN++NCGTWMDKMGSS+ AG RGKPATPRDGSAVELV L+ SVV WL   + A +YPY GV R H++G +T WT+ QWA++++ +FE+ FWV  +P A + RPDL+++R IYKD+HGAS+ +AD+QLRCNF + M VAPELFD + AW AL  VE+ LLGPLG+KTLDP DW+Y G YDNSNDS+D   AHG+NYHQGPEW+WP GFYLRA+L FA ENG   RT+A     L+ H  EL+ S WRGL ELTNA G +C  SC TQAWS A +LE LHDL+     +P+
Sbjct: 1421 EEARFHILGYAACLRHGLIPNLLDSG-NPRYNCRDAVWWWLHCIKSYVEEVSNGVEILSDTVSRLFPTDSSARQEPGVADQPLHVVMQEALKVHFQGLVFRERNAGRQIDAHMSDRGFNNQIGVHPETGFVFGGNESNCGTWMDKMGSSDKAGNRGKPATPRDGSAVELVGLSKSVVTWLDKLYHAKKYPYDGVERIHKNGNVTKWTFRQWADKIQTNFEKYFWVNMSPVAGENRPDLINKRGIYKDSHGASQEYADFQLRCNFPITMVVAPELFDSKRAWTALQKVEKYLLGPLGLKTLDPEDWSYNGIYDNSNDSEDYNTAHGFNYHQGPEWVWPMGFYLRAKLHFAAENGDLRRTIANTKVVLSRHFTELQTSVWRGLSELTNANGTFCHGSCATQAWSMACILEVLHDLQKIESKQPI 1841          
The following BLAST results are available for this feature:
BLAST of HiSeq13798 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357617443|gb|EHJ70794.1|0.000e+083.53hypothetical protein KGM_19481 [Danaus plexippus][more]
gi|930655743|gb|KPI98071.1|0.000e+082.98Glycogen debranching enzyme [Papilio xuthus][more]
gi|910347332|ref|XP_013177598.1|0.000e+083.10PREDICTED: LOW QUALITY PROTEIN: glycogen debranchi... [more]
gi|913309261|ref|XP_013185209.1|0.000e+080.61PREDICTED: glycogen debranching enzyme [Amyelois t... [more]
gi|943948296|ref|XP_014357205.1|0.000e+081.72PREDICTED: glycogen debranching enzyme [Papilio ma... [more]
gi|1179788182|gb|ARI45581.1|0.000e+066.59glycogen debranching enzyme, partial [Leptinotarsa... [more]
gi|1133429301|ref|XP_019870586.1|0.000e+064.34PREDICTED: LOW QUALITY PROTEIN: glycogen debranchi... [more]
gi|1080067539|ref|XP_018576026.1|0.000e+063.74PREDICTED: glycogen debranching enzyme isoform X2 ... [more]
gi|1080067537|ref|XP_018576025.1|0.000e+063.74PREDICTED: glycogen debranching enzyme isoform X1 ... [more]
gi|1069792087|ref|XP_018321143.1|0.000e+065.17PREDICTED: glycogen debranching enzyme [Agrilus pl... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005978 glycogen biosynthetic process
biological_process GO:0005980 glycogen catabolic process
molecular_function GO:0004134 4-alpha-glucanotransferase activity
molecular_function GO:0004135 amylo-alpha-1,6-glucosidase activity
molecular_function GO:0003824 catalytic activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010401Glycogen debranching enzymePFAMPF06202GDE_Ccoord: 10..417
e-value: 5.7E-99
score: 331.2
IPR010401Glycogen debranching enzymePANTHERPTHR10569GLYCOGEN DEBRANCHING ENZYMEcoord: 10..432
NoneNo IPR availablePANTHERPTHR10569:SF2GLYCOGEN DEBRANCHING ENZYMEcoord: 10..432
IPR008928Six-hairpin glycosidase-likeSUPERFAMILY48208Six-hairpin glycosidasescoord: 144..423
coord: 11..82

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13798HiSeq13798Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13798_p ID=HiSeq13798_p|Name=HiSeq13798|organism=Ostrinia scapulalis|type=polypeptide|length=434bp
MSIIDSIVSQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWL
HSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEAL
DVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGT
WMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPY
PGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHR
RAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLL
LGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFY
LRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAY
CADSCRTQAWSSATVLEALHDLELARRARPLAAD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0005978glycogen biosynthetic process
GO:0005980glycogen catabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0004135amylo-alpha-1,6-glucosidase activity
GO:00041344-alpha-glucanotransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR0089286-hairpin_glycosidase-like
IPR010401AGL/Gdb1