HiSeq13799_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13799
Unique NameHiSeq13799_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length478
Homology
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|357617443|gb|EHJ70794.1| (hypothetical protein KGM_19481 [Danaus plexippus])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 398/477 (83.44%), Postives = 446/477 (93.50%), Query Frame = 0
Query:    2 LPPPSPALPPPRPARAVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLAAD 478
            LP  SP+LP  RPAR +SLSAGLPHFAVGYMRCWGRDTF+ALRG+FLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNAR+NCRDAVWWWL SIKQYC+EAP G++IL +PVSR+FPKDDSEPAPPGAADQPLHDVMQEALDVHFQGL FRER AGR IDAHM+D+GFN+QIGVDP+TGFPFGGN+ANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVA+A+ V +WLAAQHR+A+YPYPGV RRHRDG+LT+WTY+QWA+R+R SFER FWVPAAPSAAD RPDLVHRRAIYKDTHGAS+PWADYQLRCN+VVAMA+APELFDPRHAWLALD VE+LL+GPLG+KTLDP DWAYR +YDNS++S DP+VAHG+NYHQGPEW WP GFYLRARLAFAH+NG+ ++TVAAAYAALAP +AE+R+SPWRGLPEL+NAGGA+C DSCRTQAWSS+ +LE LHDLEL+RRARPL  D
Sbjct: 1183 LPAMSPSLPMLRPARPLSLSAGLPHFAVGYMRCWGRDTFIALRGMFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARFNCRDAVWWWLQSIKQYCTEAPQGYSILTDPVSRIFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLVFRERNAGRQIDAHMSDKGFNIQIGVDPETGFPFGGNEANCGTWMDKMGSSETAGTRGKPATPRDGSAVELVAMAYCVASWLAAQHRSAKYPYPGVARRHRDGSLTAWTYSQWADRIRRSFERHFWVPAAPSAADQRPDLVHRRAIYKDTHGASQPWADYQLRCNYVVAMALAPELFDPRHAWLALDNVEKLLVGPLGLKTLDPEDWAYRPNYDNSDNSSDPSVAHGFNYHQGPEWTWPLGFYLRARLAFAHDNGQFSKTVAAAYAALAPLVAEMRSSPWRGLPELSNAGGAFCKDSCRTQAWSSSCMLEVLHDLELSRRARPLPLD 1659          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|930655743|gb|KPI98071.1| (Glycogen debranching enzyme [Papilio xuthus])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 387/467 (82.87%), Postives = 422/467 (90.36%), Query Frame = 0
Query:   10 PPPRPARAVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLA 476
            P P      SLSAGLPHFAVGYMRCWGRDTF+ALRGLFLLTGRYQ+A+ HIL F ACLRHGLIPNLLDGGRNARYNCRDAVWWWL SIKQYC E P G A+L E V+RL+P+DD EPAPPG+ADQPLHDVMQEALDVHFQGL FRER AGRAIDAHM+D+GFNVQIG+DP+TGFPFGGNDANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVALA+SV +WLAAQHRAAR+PYPGV RRHRDG+LT+WTYAQWA+R+R +FER FWVPAAP AAD RPDLVHRRAIYKDTH A+RPWADYQLRCNF VAMAVAP++FDP+HAWLALD VERLLLGPLGVKTLDPADWAYRGDYDNSN+SDDP VAHG+NYHQGPEW+WP G+YL ARLAFA ENGK+A+TVAA YA LAP +AELR+SPWRGLPELTNAGGA+CA SCRTQAWS+ATVLEAL + E  R AR L 
Sbjct: 1230 PLPAVRDQASLSAGLPHFAVGYMRCWGRDTFIALRGLFLLTGRYQEAKAHILSFGACLRHGLIPNLLDGGRNARYNCRDAVWWWLQSIKQYCCEVPGGGALLAEGVARLYPRDDCEPAPPGSADQPLHDVMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNVQIGIDPETGFPFGGNDANCGTWMDKMGSSEAAGTRGKPATPRDGSAVELVALAYSVASWLAAQHRAARFPYPGVARRHRDGSLTAWTYAQWADRIRRNFERYFWVPAAPGAADLRPDLVHRRAIYKDTHAATRPWADYQLRCNFPVAMAVAPDIFDPKHAWLALDNVERLLLGPLGVKTLDPADWAYRGDYDNSNNSDDPNVAHGFNYHQGPEWVWPIGYYLMARLAFAQENGKYAKTVAATYATLAPLVAELRSSPWRGLPELTNAGGAFCAGSCRTQAWSAATVLEALREAEALRDARTLT 1696          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|910347332|ref|XP_013177598.1| (PREDICTED: LOW QUALITY PROTEIN: glycogen debranching enzyme [Papilio xuthus])

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 385/464 (82.97%), Postives = 421/464 (90.73%), Query Frame = 0
Query:   10 PPPRPARAVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRAR 473
            P P      SLSAGLPHFAVGYMRCWGRDTF+ALRGLFLLTGRYQ+A+ HIL F ACLRHGLIPNLLDGGRNARYNCRDAVWWWL SIKQYC E P G A+L E V+RL+P+DD EPAPPG+A+QPLHDVMQEALDVHFQGL FRER AGRAIDAHM+D+GFNVQIG+DP+TGFPFGGNDANCGTWMDKMGSSE AGTRGKPATPRDGSAVELVALA+SV +WLAAQHRAAR+PYPGV RRHRDG+LT+WTYAQWA+R+R +FER FWVPAAP AAD RPDLVHRRAIYKDTH A+RPWADYQLRCNF VAMAVAP++FDP+HAWLALD VERLLLGPLGVKTLDPADWAYRGDYDNSN+SDDP VAHG+NYHQGPEW+WP G+YL ARLAFA ENGK+A+TVAA YA LAP +AELR+SPWRGLPELTNAGGA+CA SCRTQAWS+ATVLEAL + E  R AR
Sbjct: 1123 PLPAVRDQASLSAGLPHFAVGYMRCWGRDTFIALRGLFLLTGRYQEAKAHILSFGACLRHGLIPNLLDGGRNARYNCRDAVWWWLQSIKQYCCEVPGGGALLAEGVARLYPRDDCEPAPPGSANQPLHDVMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNVQIGIDPETGFPFGGNDANCGTWMDKMGSSEAAGTRGKPATPRDGSAVELVALAYSVASWLAAQHRAARFPYPGVARRHRDGSLTAWTYAQWADRIRRNFERYFWVPAAPGAADLRPDLVHRRAIYKDTHAATRPWADYQLRCNFPVAMAVAPDIFDPKHAWLALDNVERLLLGPLGVKTLDPADWAYRGDYDNSNNSDDPNVAHGFNYHQGPEWVWPIGYYLMARLAFAQENGKYAKTVAATYATLAPLVAELRSSPWRGLPELTNAGGAFCAGSCRTQAWSAATVLEALREAEALRDAR 1586          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|913309261|ref|XP_013185209.1| (PREDICTED: glycogen debranching enzyme [Amyelois transitella])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 373/459 (81.26%), Postives = 413/459 (89.98%), Query Frame = 0
Query:   17 AVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPL 475
            +++LSAGLPHFAVGYMRCWGRDTFVALRG+FLLT RYQDARFHILGFAACLRHGLIPNLLDGG  ARYNCRDAVWWWL SIK+YCS +P G  +L EPVSRLFP+DDSEPAPPGAAD PLHD+MQEALDVHFQGL FRER AGRAIDAHM+D+GFN+QIGVDP+TGFPFGGNDANCGTWMDKMGSS+ AG RGKPATPRDGSAVELV LA+SVV+WL+AQHRAARYPY GVVRRHRDG+LTSWT+ QWA+++R++FER FW+P+APSAAD RPDLVHRR +YKD+HGASRPWADYQLRCNF +AMAVAP+LFDP+ AW ALD VE+LLLGPLG+KTLDP DWAYRGDYDNSN+SDDP+VAHG+NYHQGPEW WP GFYL ARL FA   G+ ART+ A YAAL P  AE+  +PWRGLPEL NAGGAYC DSCRTQAWSSA VLE LH LE ARRARPL
Sbjct: 1110 SLTLSAGLPHFAVGYMRCWGRDTFVALRGMFLLTERYQDARFHILGFAACLRHGLIPNLLDGGPRARYNCRDAVWWWLQSIKEYCSMSPQGCGLLSEPVSRLFPQDDSEPAPPGAADMPLHDIMQEALDVHFQGLVFRERNAGRAIDAHMSDKGFNIQIGVDPETGFPFGGNDANCGTWMDKMGSSDIAGNRGKPATPRDGSAVELVGLAYSVVSWLSAQHRAARYPYQGVVRRHRDGSLTSWTFGQWADKIRSNFERYFWIPSAPSAADQRPDLVHRRGVYKDSHGASRPWADYQLRCNFPIAMAVAPDLFDPKRAWAALDMVEKLLLGPLGLKTLDPEDWAYRGDYDNSNNSDDPSVAHGFNYHQGPEWTWPLGFYLLARLRFAQAAGRAARTLGAVYAALGPLSAEIHGAPWRGLPELANAGGAYCRDSCRTQAWSSALVLEVLHALEAARRARPL 1568          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|1179788182|gb|ARI45581.1| (glycogen debranching enzyme, partial [Leptinotarsa decemlineata])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 318/482 (65.98%), Postives = 380/482 (78.84%), Query Frame = 0
Query:    2 LPPPSPALPPPRP-----------ARAVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRA 472
            LP  SP L PP+P              V+LSAGLPHF+VGYMR WGRDTF+ALRGLF+LTGRYQ+AR HILG+AACLRHGLIPNLLDGGRN R+NCRDAVWWWLH IK+Y +EAP G +IL + VSR+FPKDDS   PPGA DQPLHDVMQEAL+VHFQGLAFRER AG+ ID HM D+GFN QIGV P+TGF FGGN  NCGTWMDKMGSS+ AG RGKPATPRDGSAVEL+ L+ SV++WLA      +YPYPGV R H+DG +T WT+ +W+++++A+FE+ FW+ + P+  + RPDL+++R IYKD H AS+ W D+QLRCNF VAM  APELF P HAW AL   E+ LLGPLG+KTLDP DWAYRGDY+NSNDS+DP VA+G+NYHQGPEW+WP GF+LRA+L FA +NG    T+A+A   L+ H  EL+ SPWRGLPELTN  G+YC+DS RTQAWS + VLE L+D +   RA
Sbjct: 1137 LPTLSPNLAPPKPLTRKTDSGEVVQACVTLSAGLPHFSVGYMRNWGRDTFIALRGLFILTGRYQEAREHILGYAACLRHGLIPNLLDGGRNPRFNCRDAVWWWLHCIKEYVTEAPDGISILSDKVSRIFPKDDSAAQPPGAVDQPLHDVMQEALNVHFQGLAFRERNAGKQIDEHMTDQGFNNQIGVHPETGFIFGGNQWNCGTWMDKMGSSDKAGNRGKPATPRDGSAVELIGLSKSVISWLAKLDAEKKYPYPGVERTHKDGRITRWTFKEWSDKIQANFEKHFWINSKPTEGEIRPDLINKRGIYKDCHDASQEWTDFQLRCNFPVAMVAAPELFSPSHAWEALAQAEKYLLGPLGMKTLDPKDWAYRGDYNNSNDSNDPTVANGFNYHQGPEWVWPIGFFLRAKLIFAAQNGALKETLASAKLILSKHFVELQTSPWRGLPELTNTNGSYCSDSSRTQAWSMSCVLEVLYDFKKLSRA 1618          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|1080067539|ref|XP_018576026.1| (PREDICTED: glycogen debranching enzyme isoform X2 [Anoplophora glabripennis])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 307/485 (63.30%), Postives = 371/485 (76.49%), Query Frame = 0
Query:    2 LPPPSPALPPPRPAR-----------AVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPL 475
            LP  SP+L PP+P              V+LSAGLPHFAVGYMR WGRDTF++LRGLF+LTGR+++AR HILG+AACLRHGLIPNLLDGGRN+R+NCRDAVWWWL+ IK+Y  EAP G  IL + VSR+FP DDS   PPGA DQPLHDVMQEAL VHFQGL FRER AGR ID HM DRGFN QIGV P+TGF FGGN  NCGTWMDKMGSS+ AG RG PATPRDGSAVEL+ L+ +V+ WL   ++  +YPY GV R H++G++T WT+ +W+++++A+FE+ FW+   P   + R DL+HRR IYKD+ GAS  WAD+QLRCNF +AM  APELF P+ AW AL   E+ LLGPLG+KTLDP DW Y G+YDNSNDS DP+VA+G+NYHQGPEW+WP GF+LRA+L FA  NG    T+A     L+ H  EL++S WRGLPELTN+ G+YC DS RTQAWS A +LE LHDL+     +P+
Sbjct: 1938 LPVLSPSLAPPKPPTRKNDKGESVQACVTLSAGLPHFAVGYMRNWGRDTFISLRGLFILTGRFEEARQHILGYAACLRHGLIPNLLDGGRNSRFNCRDAVWWWLYCIKEYVEEAPNGDKILTDKVSRIFPTDDSPAQPPGAVDQPLHDVMQEALKVHFQGLTFRERNAGRQIDEHMTDRGFNNQIGVHPETGFVFGGNGWNCGTWMDKMGSSDKAGNRGGPATPRDGSAVELIGLSKAVITWLWKLNQNKKYPYSGVERTHKNGSVTKWTFKEWSDKIQANFEKYFWISNTPVPEEYRSDLIHRRGIYKDSFGASNVWADFQLRCNFPIAMVAAPELFTPQQAWTALRQAEKHLLGPLGMKTLDPKDWLYNGNYDNSNDSTDPSVANGFNYHQGPEWVWPVGFFLRAKLHFASLNGVLNETIADTKVVLSKHFTELQSSVWRGLPELTNSNGSYCRDSSRTQAWSMACILEVLHDLQKIESNQPV 2422          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|1080067537|ref|XP_018576025.1| (PREDICTED: glycogen debranching enzyme isoform X1 [Anoplophora glabripennis])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 307/485 (63.30%), Postives = 371/485 (76.49%), Query Frame = 0
Query:    2 LPPPSPALPPPRPAR-----------AVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPL 475
            LP  SP+L PP+P              V+LSAGLPHFAVGYMR WGRDTF++LRGLF+LTGR+++AR HILG+AACLRHGLIPNLLDGGRN+R+NCRDAVWWWL+ IK+Y  EAP G  IL + VSR+FP DDS   PPGA DQPLHDVMQEAL VHFQGL FRER AGR ID HM DRGFN QIGV P+TGF FGGN  NCGTWMDKMGSS+ AG RG PATPRDGSAVEL+ L+ +V+ WL   ++  +YPY GV R H++G++T WT+ +W+++++A+FE+ FW+   P   + R DL+HRR IYKD+ GAS  WAD+QLRCNF +AM  APELF P+ AW AL   E+ LLGPLG+KTLDP DW Y G+YDNSNDS DP+VA+G+NYHQGPEW+WP GF+LRA+L FA  NG    T+A     L+ H  EL++S WRGLPELTN+ G+YC DS RTQAWS A +LE LHDL+     +P+
Sbjct: 1944 LPVLSPSLAPPKPPTRKNDKGESVQACVTLSAGLPHFAVGYMRNWGRDTFISLRGLFILTGRFEEARQHILGYAACLRHGLIPNLLDGGRNSRFNCRDAVWWWLYCIKEYVEEAPNGDKILTDKVSRIFPTDDSPAQPPGAVDQPLHDVMQEALKVHFQGLTFRERNAGRQIDEHMTDRGFNNQIGVHPETGFVFGGNGWNCGTWMDKMGSSDKAGNRGGPATPRDGSAVELIGLSKAVITWLWKLNQNKKYPYSGVERTHKNGSVTKWTFKEWSDKIQANFEKYFWISNTPVPEEYRSDLIHRRGIYKDSFGASNVWADFQLRCNFPIAMVAAPELFTPQQAWTALRQAEKHLLGPLGMKTLDPKDWLYNGNYDNSNDSTDPSVANGFNYHQGPEWVWPVGFFLRAKLHFASLNGVLNETIADTKVVLSKHFTELQSSVWRGLPELTNSNGSYCRDSSRTQAWSMACILEVLHDLQKIESNQPV 2428          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|1133429301|ref|XP_019870586.1| (PREDICTED: LOW QUALITY PROTEIN: glycogen debranching enzyme-like [Aethina tumida])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 295/451 (65.41%), Postives = 362/451 (80.27%), Query Frame = 0
Query:   18 VSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLEL 468
            V+LSAGLPHF+ GYMR WGRDTF++LRG+ LLTGRY++AR  ILG+AACLRHGLIPNLL GG  +RYNCRDAVWWW+H IK+YC+E P G  IL + VSRLFP DDS P P G  DQPLH+V+QEAL +HFQGLAFRER AG +IDAHM D+GFN QIG+ P+TGF FGGN+ NCGTWMDKMGSS+ AG RGKPATPRDGSAVELV L++SV +WLA  +   +YP+ GV R H++G  T+WT+ +W+E+++A+FE+ FW+  +P+  + RPDL+++R IYKD+HGAS+ WAD+QLRCNF + M VAPELF+ +HAW AL   E+ LLGPLG++TLDP DWAY G+YDNSNDSDD  VAHG NYHQGPEW+WP GF+LRA+L FA +NG    T++     L+ H  EL+ SPWRGLPELTN  GAYC  SCRTQAWS A +LE L+DL+L
Sbjct: 2149 VTLSAGLPHFSTGYMRNWGRDTFISLRGILLLTGRYEEARQTILGYAACLRHGLIPNLLFGGAQSRYNCRDAVWWWMHCIKEYCTEVPNGCDILNDVVSRLFPTDDSPPLPAGTVDQPLHEVIQEALTIHFQGLAFRERNAGGSIDAHMTDKGFNNQIGIHPETGFVFGGNEWNCGTWMDKMGSSDKAGNRGKPATPRDGSAVELVGLSYSVTSWLATLYEKQQYPHSGVTRTHKNGTTTTWTFKEWSEKIKANFEKYFWISGSPAKDEIRPDLINKRGIYKDSHGASQDWADFQLRCNFPITMVVAPELFNAQHAWTALQQAEKYLLGPLGMRTLDPEDWAYNGNYDNSNDSDDFKVAHGLNYHQGPEWVWPVGFFLRAKLRFAADNGALIETLSKVKVVLSRHFVELQTSPWRGLPELTNKDGAYCEGSCRTQAWSMACILEVLNDLQL 2599          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|1133440478|ref|XP_019876629.1| (PREDICTED: LOW QUALITY PROTEIN: glycogen debranching enzyme-like [Aethina tumida])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 295/451 (65.41%), Postives = 362/451 (80.27%), Query Frame = 0
Query:   18 VSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLEL 468
            V+LSAGLPHF+ GYMR WGRDTF++LRG+ LLTGRY++AR  ILG+AACLRHGLIPNLL GG  +RYNCRDAVWWW+H IK+YC+E P G  IL + VSRLFP DDS P P G  DQPLH+V+QEAL +HFQGLAFRER AG +IDAHM D+GFN QIG+ P+TGF FGGN+ NCGTWMDKMGSS+ AG RGKPATPRDGSAVELV L++SV +WLA  +   +YP+ GV R H++G  T+WT+ +W+E+++A+FE+ FW+  +P+  + RPDL+++R IYKD+HGAS+ WAD+QLRCNF + M VAPELF+ +HAW AL   E+ LLGPLG++TLDP DWAY G+YDNSNDSDD  VAHG NYHQGPEW+WP GF+LRA+L FA +NG    T++     L+ H  EL+ SPWRGLPELTN  GAYC  SCRTQAWS A +LE L+DL+L
Sbjct: 1090 VTLSAGLPHFSTGYMRNWGRDTFISLRGILLLTGRYEEARQTILGYAACLRHGLIPNLLFGGAQSRYNCRDAVWWWMHCIKEYCTEVPNGCDILNDVVSRLFPTDDSPPLPAGTVDQPLHEVIQEALTIHFQGLAFRERNAGGSIDAHMTDKGFNNQIGIHPETGFVFGGNEWNCGTWMDKMGSSDKAGNRGKPATPRDGSAVELVGLSYSVTSWLATLYEKQQYPHSGVTRTHKNGTTTTWTFKEWSEKIKANFEKYFWISGSPAKDEIRPDLINKRGIYKDSHGASQDWADFQLRCNFPITMVVAPELFNAQHAWTALQQAEKYLLGPLGMRTLDPEDWAYNGNYDNSNDSDDFKVAHGLNYHQGPEWVWPVGFFLRAKLRFAADNGALIETLSKVKVVLSRHFVELQTSPWRGLPELTNKDGAYCEGSCRTQAWSMACILEVLNDLQL 1540          
BLAST of HiSeq13799 vs. genbank:protein
Match: gi|546678137|gb|ERL88846.1| (hypothetical protein D910_06228 [Dendroctonus ponderosae])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 300/486 (61.73%), Postives = 368/486 (75.72%), Query Frame = 0
Query:    2 LPPPSPALPPPRPAR-----------AVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLTGRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQYCSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQGLAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMGSSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRRHRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKDTHGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGVKTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLAFAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCRTQAWSSATVLEALHDLELARRARPLA 476
            LP  SP L PP+P              V+LSAGLPHFAVGYMR WGRDTF+ALRGLF+LTGR+++AR HILG+ +CLRHGLIPNLLD GRN R+NCRDA+WWWL+S+K YC E+P G AIL + VSR+FP DDS P PPGA DQPL+DV+QE+L VHFQGL FRER AGR ID HM D GFN QIG  P+TGF FGGN+ NCGTWMDKMGSS+ AG RGKPA+PRDGSAVELV L+ + + WL   +   +YPY GV R H++G +T WT+ +W+++++ +FE+ FW+   P+  + RPDLV+++ IYKD+ GAS+PW D+QLRCNF +AM  APELF+P+ AW AL+ VE+ LLGPLG+KTLDP DW YRGDYDNS DSDD   AHG+NYHQGPEW+WP GF+LRA+L FA +NG    TV      L+ H  E+   PWRGLPELTN+ G+YC DS RTQAWS + +LE L+DLE     R +A
Sbjct: 1232 LPDMSPNLAPPKPPSRKNENGETVQACVTLSAGLPHFAVGYMRNWGRDTFIALRGLFILTGRFEEARQHILGYGSCLRHGLIPNLLDAGRNPRFNCRDAIWWWLYSLKSYCEESPKGVAILADVVSRIFPSDDSSPQPPGAVDQPLYDVIQESLTVHFQGLQFRERNAGREIDEHMTDAGFNNQIGTHPETGFVFGGNEWNCGTWMDKMGSSDKAGNRGKPASPRDGSAVELVGLSKACITWLMHLNDEGQYPYDGVQRTHKNGTVTKWTFREWSDKIQQNFEKKFWISGNPNPEECRPDLVNKKNIYKDSFGASQPWTDFQLRCNFPIAMVAAPELFNPQRAWAALEQVEKYLLGPLGMKTLDPEDWNYRGDYDNSIDSDDLLTAHGFNYHQGPEWVWPVGFFLRAKLIFAAQNGLLDETVTKTKQILSKHFIEVETPPWRGLPELTNSDGSYCPDSARTQAWSMSCILEVLYDLEKIESNRSVA 1717          
The following BLAST results are available for this feature:
BLAST of HiSeq13799 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357617443|gb|EHJ70794.1|0.000e+083.44hypothetical protein KGM_19481 [Danaus plexippus][more]
gi|930655743|gb|KPI98071.1|0.000e+082.87Glycogen debranching enzyme [Papilio xuthus][more]
gi|910347332|ref|XP_013177598.1|0.000e+082.97PREDICTED: LOW QUALITY PROTEIN: glycogen debranchi... [more]
gi|913309261|ref|XP_013185209.1|0.000e+081.26PREDICTED: glycogen debranching enzyme [Amyelois t... [more]
gi|1179788182|gb|ARI45581.1|0.000e+065.98glycogen debranching enzyme, partial [Leptinotarsa... [more]
gi|1080067539|ref|XP_018576026.1|0.000e+063.30PREDICTED: glycogen debranching enzyme isoform X2 ... [more]
gi|1080067537|ref|XP_018576025.1|0.000e+063.30PREDICTED: glycogen debranching enzyme isoform X1 ... [more]
gi|1133429301|ref|XP_019870586.1|0.000e+065.41PREDICTED: LOW QUALITY PROTEIN: glycogen debranchi... [more]
gi|1133440478|ref|XP_019876629.1|0.000e+065.41PREDICTED: LOW QUALITY PROTEIN: glycogen debranchi... [more]
gi|546678137|gb|ERL88846.1|0.000e+061.73hypothetical protein D910_06228 [Dendroctonus pond... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005980 glycogen catabolic process
molecular_function GO:0004134 4-alpha-glucanotransferase activity
molecular_function GO:0004135 amylo-alpha-1,6-glucosidase activity
molecular_function GO:0003824 catalytic activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010401Glycogen debranching enzymePFAMPF06202GDE_Ccoord: 16..461
e-value: 1.1E-116
score: 389.5
IPR010401Glycogen debranching enzymePANTHERPTHR10569GLYCOGEN DEBRANCHING ENZYMEcoord: 1..476
NoneNo IPR availablePANTHERPTHR10569:SF2GLYCOGEN DEBRANCHING ENZYMEcoord: 1..476
IPR008928Six-hairpin glycosidase-likeSUPERFAMILY48208Six-hairpin glycosidasescoord: 188..467
coord: 19..126

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13799HiSeq13799Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13799_p ID=HiSeq13799_p|Name=HiSeq13799|organism=Ostrinia scapulalis|type=polypeptide|length=478bp
SLPPPSPALPPPRPARAVSLSAGLPHFAVGYMRCWGRDTFVALRGLFLLT
GRYQDARFHILGFAACLRHGLIPNLLDGGRNARYNCRDAVWWWLHSIKQY
CSEAPAGHAILGEPVSRLFPKDDSEPAPPGAADQPLHDVMQEALDVHFQG
LAFRERRAGRAIDAHMADRGFNVQIGVDPDTGFPFGGNDANCGTWMDKMG
SSEPAGTRGKPATPRDGSAVELVALAHSVVAWLAAQHRAARYPYPGVVRR
HRDGALTSWTYAQWAERLRASFERAFWVPAAPSAADARPDLVHRRAIYKD
THGASRPWADYQLRCNFVVAMAVAPELFDPRHAWLALDAVERLLLGPLGV
KTLDPADWAYRGDYDNSNDSDDPAVAHGYNYHQGPEWLWPFGFYLRARLA
FAHENGKHARTVAAAYAALAPHLAELRASPWRGLPELTNAGGAYCADSCR
TQAWSSATVLEALHDLELARRARPLAAD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:00041344-alpha-glucanotransferase activity
GO:0004135amylo-alpha-1,6-glucosidase activity
Vocabulary: Biological Process
TermDefinition
GO:0005980glycogen catabolic process
Vocabulary: INTERPRO
TermDefinition
IPR0089286-hairpin_glycosidase-like
IPR010401AGL/Gdb1