HiSeq138_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq138
Unique NameHiSeq138_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length92
Homology
BLAST of HiSeq138 vs. genbank:protein
Match: gi|357610323|gb|EHJ66930.1| (beta 1,4-N-acetylgalactosaminyltransferase [Danaus plexippus])

HSP 1 Score: 132.494 bits (332), Expect = 4.642e-37
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF 92
            L N GYLE +K GNW+C+VFHDVDLLP  DRI YSCP WPRHM   V+   ++ ++++ +GGVS M P  FEKVNG+SN YWGWGGED D+F
Sbjct:   25 LFNAGYLEVRKFGNWKCVVFHDVDLLPLDDRILYSCPMWPRHMCGTVV-EVKNPSFRTLFGGVSAMIPQHFEKVNGFSNVYWGWGGEDNDLF 115          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|158297873|ref|XP_318033.4| (AGAP004781-PA [Anopheles gambiae str. PEST] >gi|157014536|gb|EAA13217.4| AGAP004781-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 122.094 bits (305), Expect = 5.853e-32
Identity = 53/91 (58.24%), Postives = 63/91 (69.23%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDM 91
            L+N+G++EA K  NWECMVFHD+DLLP  DR  Y+CP  PRHMS  V        Y + +GGVS MT  QF  VNG+SN +WGWGGED DM
Sbjct:  128 LMNIGFVEAMKQKNWECMVFHDIDLLPMDDRNLYTCPDQPRHMSVAVDTFGFKLPYSTIFGGVSAMTEKQFRMVNGFSNAFWGWGGEDDDM 218          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|512906885|ref|XP_004926305.1| (PREDICTED: uncharacterized protein LOC101738741 [Bombyx mori])

HSP 1 Score: 122.479 bits (306), Expect = 1.448e-31
Identity = 52/94 (55.32%), Postives = 67/94 (71.28%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSH--YGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF 92
            L NVG+ E  K+ NW+C+VFHDVDL+P  DRI Y+CP++PRHM   V+ +     YK H  +GGVS M+   FE VNG++N YWGWGGED D+F
Sbjct:  238 LFNVGFKEIFKYNNWQCVVFHDVDLIPLDDRILYTCPSFPRHMCGTVVQKENLPYYKYHTLFGGVSSMSVRHFEAVNGFANVYWGWGGEDNDLF 331          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|389613071|dbj|BAM19915.1| (beta-1,4-galactosyltransferase [Papilio xuthus])

HSP 1 Score: 117.857 bits (294), Expect = 1.951e-31
Identity = 53/94 (56.38%), Postives = 66/94 (70.21%), Query Frame = 0
Query:    1 LLNVGYLEAKKH--GNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF 92
            L+NVG++E++K   G W+C +FHD+DLLP   R  YSCP  PRHMSA +        Y+  +GGVS MT  QF KVNG+SN+YWGWGGED DMF
Sbjct:   30 LMNVGFMESQKQKAGGWQCFIFHDIDLLPLDQRNLYSCPRQPRHMSASIDKLNFRLPYEEIFGGVSAMTLEQFTKVNGFSNKYWGWGGEDDDMF 123          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|668459143|gb|KFB46965.1| (AGAP004781-PA-like protein [Anopheles sinensis])

HSP 1 Score: 124.02 bits (310), Expect = 3.271e-31
Identity = 53/91 (58.24%), Postives = 63/91 (69.23%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDM 91
            L+N+G++EA K  NWECMVFHD+DLLP  DR  Y+CP  PRHMS  V        Y + +GGVS MT  QF  VNG+SN +WGWGGED DM
Sbjct:  294 LMNIGFVEAMKQKNWECMVFHDIDLLPMDDRNLYTCPDQPRHMSVAVDTFSFKLPYSTIFGGVSAMTEKQFRMVNGFSNSFWGWGGEDDDM 384          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|357612720|gb|EHJ68143.1| (beta 1,4-N-acetylgalactosaminyltransferase [Danaus plexippus])

HSP 1 Score: 120.168 bits (300), Expect = 6.717e-31
Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF 92
            L+NVG++E+++  +W+C +FHD+DLLP   R  YSCP  PRHMSA +        Y+  +GGVS MT  QF KVNG+SN+YWGWGGED DMF
Sbjct:  170 LMNVGFVESQRQRSWQCFIFHDIDLLPLDSRNMYSCPKQPRHMSASIDKLNFRLPYEDIFGGVSAMTLEQFTKVNGFSNKYWGWGGEDDDMF 261          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|930660364|gb|KPJ02356.1| (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Papilio xuthus])

HSP 1 Score: 120.553 bits (301), Expect = 2.255e-30
Identity = 53/94 (56.38%), Postives = 66/94 (70.21%), Query Frame = 0
Query:    1 LLNVGYLEAKKH--GNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF 92
            L+NVG++E++K   G W+C +FHD+DLLP   R  YSCP  PRHMSA +        Y+  +GGVS MT  QF KVNG+SN+YWGWGGED DMF
Sbjct:  294 LMNVGFMESQKQKAGGWQCFIFHDIDLLPLDQRNLYSCPRQPRHMSASIDKLNFRLPYEEIFGGVSAMTLEQFTKVNGFSNKYWGWGGEDDDMF 387          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|910352233|ref|XP_013180066.1| (PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like [Papilio xuthus])

HSP 1 Score: 119.783 bits (299), Expect = 2.916e-30
Identity = 53/94 (56.38%), Postives = 66/94 (70.21%), Query Frame = 0
Query:    1 LLNVGYLEAKKH--GNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF 92
            L+NVG++E++K   G W+C +FHD+DLLP   R  YSCP  PRHMSA +        Y+  +GGVS MT  QF KVNG+SN+YWGWGGED DMF
Sbjct:  251 LMNVGFMESQKQKAGGWQCFIFHDIDLLPLDQRNLYSCPRQPRHMSASIDKLNFRLPYEEIFGGVSAMTLEQFTKVNGFSNKYWGWGGEDDDMF 344          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|157131163|ref|XP_001662147.1| (AAEL012002-PA [Aedes aegypti] >gi|108871640|gb|EAT35865.1| AAEL012002-PA [Aedes aegypti])

HSP 1 Score: 120.553 bits (301), Expect = 3.404e-30
Identity = 54/91 (59.34%), Postives = 62/91 (68.13%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDM 91
            L+NVG+ EA K  NW+CMVFHDVDLLP  DR  Y+CP  PRHMS  V        Y + +GGVS MT  QF  VNG+SN +WGWGGED DM
Sbjct:  315 LMNVGFAEAMKQKNWDCMVFHDVDLLPMDDRNLYTCPDQPRHMSVAVDTFGFKLPYSTIFGGVSAMTAKQFRTVNGFSNSFWGWGGEDDDM 405          
BLAST of HiSeq138 vs. genbank:protein
Match: gi|1000211490|gb|KXJ81255.1| (hypothetical protein RP20_CCG020802 [Aedes albopictus])

HSP 1 Score: 121.324 bits (303), Expect = 3.996e-30
Identity = 54/91 (59.34%), Postives = 62/91 (68.13%), Query Frame = 0
Query:    1 LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGRPESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDM 91
            L+NVG+ EA K  NW+CMVFHDVDLLP  DR  Y+CP  PRHMS  V        Y + +GGVS MT  QF  VNG+SN +WGWGGED DM
Sbjct:  323 LMNVGFAEAMKQKNWDCMVFHDVDLLPMDDRNLYTCPDQPRHMSVAVDTFGFKLPYSTIFGGVSAMTAKQFRTVNGFSNSFWGWGGEDDDM 413          
The following BLAST results are available for this feature:
BLAST of HiSeq138 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357610323|gb|EHJ66930.1|4.642e-3761.96beta 1,4-N-acetylgalactosaminyltransferase [Danaus... [more]
gi|158297873|ref|XP_318033.4|5.853e-3258.24AGAP004781-PA [Anopheles gambiae str. PEST] >gi|15... [more]
gi|512906885|ref|XP_004926305.1|1.448e-3155.32PREDICTED: uncharacterized protein LOC101738741 [B... [more]
gi|389613071|dbj|BAM19915.1|1.951e-3156.38beta-1,4-galactosyltransferase [Papilio xuthus][more]
gi|668459143|gb|KFB46965.1|3.271e-3158.24AGAP004781-PA-like protein [Anopheles sinensis][more]
gi|357612720|gb|EHJ68143.1|6.717e-3155.43beta 1,4-N-acetylgalactosaminyltransferase [Danaus... [more]
gi|930660364|gb|KPJ02356.1|2.255e-3056.38Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [... [more]
gi|910352233|ref|XP_013180066.1|2.916e-3056.38PREDICTED: beta-1,4-N-acetylgalactosaminyltransfer... [more]
gi|157131163|ref|XP_001662147.1|3.404e-3059.34AAEL012002-PA [Aedes aegypti] >gi|108871640|gb|EAT... [more]
gi|1000211490|gb|KXJ81255.1|3.996e-3059.34hypothetical protein RP20_CCG020802 [Aedes albopic... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005975 carbohydrate metabolic process
molecular_function GO:0016740 transferase activity
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003859Beta-1,4-galactosyltransferasePRINTSPR02050B14GALTRFASEcoord: 17..36
score: 52.86
coord: 54..75
score: 36.88
coord: 76..92
score: 57.21
IPR003859Beta-1,4-galactosyltransferasePANTHERPTHR19300BETA-1,4-GALACTOSYLTRANSFERASEcoord: 1..92
IPR029044Nucleotide-diphospho-sugar transferasesGENE3D3.90.550.10coord: 1..92
e-value: 3.5E-36
score: 124.4
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILY53448Nucleotide-diphospho-sugar transferasescoord: 2..92
IPR027791Galactosyltransferase, C-terminalPFAMPF02709Glyco_transf_7Ccoord: 53..92
e-value: 8.5E-16
score: 57.0
IPR027995Galactosyltransferase, N-terminalPFAMPF13733Glyco_transf_7Ncoord: 1..37
e-value: 1.2E-12
score: 47.2
NoneNo IPR availablePANTHERPTHR19300:SF30BETA4GALNACTAcoord: 1..92

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq138HiSeq138Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq138_p ID=HiSeq138_p|Name=HiSeq138|organism=Ostrinia scapulalis|type=polypeptide|length=92bp
LLNVGYLEAKKHGNWECMVFHDVDLLPTTDRIKYSCPTWPRHMSAYVIGR
PESENYKSHYGGVSVMTPSQFEKVNGYSNRYWGWGGEDTDMF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR027995Galactosyl_T_N
IPR027791Galactosyl_T_C
IPR029044Nucleotide-diphossugar_trans
IPR003859Galactosyl_T