HiSeq1983_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq1983
Unique NameHiSeq1983_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length155
Homology
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|909563124|ref|XP_013136764.1| (PREDICTED: zinc finger protein 141-like isoform X2 [Papilio polytes])

HSP 1 Score: 238.424 bits (607), Expect = 2.259e-75
Identity = 111/156 (71.15%), Postives = 132/156 (84.62%), Query Frame = 0
Query:    1 RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            R HTGERP+PCDVCG+AFRR TAMRNHRLIH+GVRAWAC RCPKRFRIRSDLRTH RLKHP ++ V E++GLNPT +E+M+++  NNI+H +++EITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct:  159 RVHTGERPYPCDVCGVAFRRSTAMRNHRLIHSGVRAWACARCPKRFRIRSDLRTHMRLKHPTYMIVFEMKGLNPTYEEIMQHIRDNNITHGRIVEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCEPPTPVNIDMFQPARRGRGIAKNPRRP 314          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|909563122|ref|XP_013136763.1| (PREDICTED: zinc finger protein 141-like isoform X1 [Papilio polytes])

HSP 1 Score: 238.424 bits (607), Expect = 4.116e-75
Identity = 111/156 (71.15%), Postives = 132/156 (84.62%), Query Frame = 0
Query:    1 RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            R HTGERP+PCDVCG+AFRR TAMRNHRLIH+GVRAWAC RCPKRFRIRSDLRTH RLKHP ++ V E++GLNPT +E+M+++  NNI+H +++EITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct:  179 RVHTGERPYPCDVCGVAFRRSTAMRNHRLIHSGVRAWACARCPKRFRIRSDLRTHMRLKHPTYMIVFEMKGLNPTYEEIMQHIRDNNITHGRIVEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCEPPTPVNIDMFQPARRGRGIAKNPRRP 334          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|930654288|gb|KPI96623.1| (Zinc finger protein 26 [Papilio xuthus])

HSP 1 Score: 240.736 bits (613), Expect = 9.150e-71
Identity = 112/156 (71.79%), Postives = 131/156 (83.97%), Query Frame = 0
Query:    1 RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            R HTGERP+PCDVCG+AFRR TAMRNHRLIH+GVRAWAC RCPKRFRIRSDLRTH RLKHP ++ V E++GLNPT DE+M+++  NNI+  ++IEITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct: 1278 RVHTGERPYPCDVCGVAFRRSTAMRNHRLIHSGVRAWACARCPKRFRIRSDLRTHMRLKHPTYMIVFEMKGLNPTYDEIMQHIRDNNITQGRIIEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCKTPTPVNIDMFQPARRGRGIAKNPRRP 1433          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|910346835|ref|XP_013177334.1| (PREDICTED: zinc finger protein 208-like [Papilio xuthus])

HSP 1 Score: 240.736 bits (613), Expect = 9.698e-71
Identity = 112/156 (71.79%), Postives = 131/156 (83.97%), Query Frame = 0
Query:    1 RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            R HTGERP+PCDVCG+AFRR TAMRNHRLIH+GVRAWAC RCPKRFRIRSDLRTH RLKHP ++ V E++GLNPT DE+M+++  NNI+  ++IEITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct: 1278 RVHTGERPYPCDVCGVAFRRSTAMRNHRLIHSGVRAWACARCPKRFRIRSDLRTHMRLKHPTYMIVFEMKGLNPTYDEIMQHIRDNNITQGRIIEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCKTPTPVNIDMFQPARRGRGIAKNPRRP 1433          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|930676110|gb|KPJ16323.1| (Guanine nucleotide-binding protein G(f) subunit alpha [Papilio machaon])

HSP 1 Score: 240.35 bits (612), Expect = 1.659e-70
Identity = 111/156 (71.15%), Postives = 131/156 (83.97%), Query Frame = 0
Query:    1 RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            R HTGERP+PCDVCG+AFRR TAMRNHRLIH+GVRAWAC RCPKRFRIRSDLRTH RLKHP ++ V E++GLNPT +E+M+++  NNI+  ++IEITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct: 1177 RVHTGERPYPCDVCGVAFRRSTAMRNHRLIHSGVRAWACARCPKRFRIRSDLRTHMRLKHPTYMIVFEMKGLNPTYEEIMQHIRENNITQGRIIEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCETPTPVNIDMFQPARRGRGIAKNPRRP 1332          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|357614348|gb|EHJ69035.1| (putative zinc finger protein 45-like protein [Danaus plexippus])

HSP 1 Score: 224.557 bits (571), Expect = 3.808e-69
Identity = 105/155 (67.74%), Postives = 126/155 (81.29%), Query Frame = 0
Query:    1 RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSDFQPPRRGRGIAKNPRRP 155
            RTHTGERP+PCDVCG+AFRR TAMRNHRLIHTGVRAWAC RCPKRFRI+SDL+TH RLKHPAHLAVIE+ G   + ++V ++L  NNI+  KVIEIT ++FAK T++I+PN +RAL +L  VPRT+V + +P      FQ PRRGRGIAK PRRP
Sbjct:  216 RTHTGERPYPCDVCGVAFRRSTAMRNHRLIHTGVRAWACLRCPKRFRIKSDLKTHLRLKHPAHLAVIEVEGTTASSEDVQQHLTLNNINQDKVIEITMITFAKDTTNIVPNSSRALGLLNDVPRTRVVWERPAQYYDVFQ-PRRGRGIAKTPRRP 369          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|943947258|ref|XP_014356755.1| (PREDICTED: uncharacterized protein LOC106709462 [Papilio machaon])

HSP 1 Score: 194.512 bits (493), Expect = 4.736e-61
Identity = 92/133 (69.17%), Postives = 110/133 (82.71%), Query Frame = 0
Query:   24 MRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            MRNHRLIH+GVRAWAC RCPKRFRIRSDLRTH RLKHP ++ V E++GLNPT +E+M+++  NNI+  ++IEITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct:    1 MRNHRLIHSGVRAWACARCPKRFRIRSDLRTHMRLKHPTYMIVFEMKGLNPTYEEIMQHIRENNITQGRIIEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCETPTPVNIDMFQPARRGRGIAKNPRRP 133          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|913329645|ref|XP_013196309.1| (PREDICTED: uncharacterized protein LOC106139417 [Amyelois transitella])

HSP 1 Score: 152.525 bits (384), Expect = 7.221e-40
Identity = 73/120 (60.83%), Postives = 89/120 (74.17%), Query Frame = 0
Query:   17 AFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDD 136
            +F+R T MRNHR    G+ AW+C RCPKRFR R+DLRTH RLKHP++LAVIEI GLNPTP++VM  L  N I H ++IEITKMSFAKGTSS++P CARALS+L  V +  V +      D
Sbjct: 1122 SFKRSTVMRNHRA--GGLPAWSCSRCPKRFRSRNDLRTHVRLKHPSYLAVIEIPGLNPTPEDVMRVLRLNGIQHERIIEITKMSFAKGTSSVVPTCARALSLLNHVLQEPVDFQSKTDTD 1239          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|827562293|ref|XP_012551841.1| (PREDICTED: zinc finger protein 62 homolog [Bombyx mori])

HSP 1 Score: 105.916 bits (263), Expect = 1.144e-23
Identity = 48/121 (39.67%), Postives = 79/121 (65.29%), Query Frame = 0
Query:   19 RRLTAMRNHRLIHTGVRAWACERCPKRFRIRSDLRTHARLKHPAHLAVIEIR---------GLNPTPDEVMEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYS 130
            R+L    N       +R W+C  CPKR++++S+L+ H R KHP+++AVIE++         GL  +P+EV++ + +N I   +++EITK+SF KG ++I+PN  R+L++L SVP+  VT S
Sbjct: 1136 RQLEHTVNRVQSQQDLRVWSCTACPKRYKVKSELKAHLRTKHPSYIAVIEVKPYTAIKKVAGLQHSPEEVLKLVASNEIPTNRIVEITKLSFPKGVTTIVPNTLRSLALLNSVPKETVTIS 1256          
BLAST of HiSeq1983 vs. genbank:protein
Match: gi|389609645|dbj|BAM18434.1| (unknown unsecreted protein [Papilio xuthus])

HSP 1 Score: 98.2117 bits (243), Expect = 1.990e-23
Identity = 49/77 (63.64%), Postives = 60/77 (77.92%), Query Frame = 0
Query:   80 MEYLNANNISHTKVIEITKMSFAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSD-FQPPRRGRGIAKNPRRP 155
            M+++  NNI+  ++IEITKMSF KGTSSI+P  ARALS+LG VPRT++T   P   + D FQP RRGRGIAKNPRRP
Sbjct:    1 MQHIRDNNITQGRIIEITKMSFEKGTSSIVPTTARALSLLGHVPRTKITCKTPTPVNIDMFQPARRGRGIAKNPRRP 77          
The following BLAST results are available for this feature:
BLAST of HiSeq1983 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909563124|ref|XP_013136764.1|2.259e-7571.15PREDICTED: zinc finger protein 141-like isoform X2... [more]
gi|909563122|ref|XP_013136763.1|4.116e-7571.15PREDICTED: zinc finger protein 141-like isoform X1... [more]
gi|930654288|gb|KPI96623.1|9.150e-7171.79Zinc finger protein 26 [Papilio xuthus][more]
gi|910346835|ref|XP_013177334.1|9.698e-7171.79PREDICTED: zinc finger protein 208-like [Papilio x... [more]
gi|930676110|gb|KPJ16323.1|1.659e-7071.15Guanine nucleotide-binding protein G(f) subunit al... [more]
gi|357614348|gb|EHJ69035.1|3.808e-6967.74putative zinc finger protein 45-like protein [Dana... [more]
gi|943947258|ref|XP_014356755.1|4.736e-6169.17PREDICTED: uncharacterized protein LOC106709462 [P... [more]
gi|913329645|ref|XP_013196309.1|7.221e-4060.83PREDICTED: uncharacterized protein LOC106139417 [A... [more]
gi|827562293|ref|XP_012551841.1|1.144e-2339.67PREDICTED: zinc finger protein 62 homolog [Bombyx ... [more]
gi|389609645|dbj|BAM18434.1|1.990e-2363.64unknown unsecreted protein [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0030154 cell differentiation
biological_process GO:0007186 G-protein coupled receptor signaling pathway
biological_process GO:0002376 immune system process
biological_process GO:0048731 system development
molecular_function GO:0031683 G-protein beta/gamma-subunit complex binding
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0046872 metal ion binding
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0004871 signal transducer activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015880Zinc finger, C2H2-likeSMARTSM00355ZnF_C2H2coord: 9..31
e-value: 0.018
score: 24.2
coord: 37..60
e-value: 0.17
score: 21.0
NoneNo IPR availablePFAMPF13894zf-C2H2_4coord: 37..57
e-value: 0.001
score: 19.1
NoneNo IPR availablePFAMPF13465zf-H2C2_2coord: 1..19
e-value: 1.4E-5
score: 24.9
NoneNo IPR availablePANTHERPTHR24409FAMILY NOT NAMEDcoord: 1..57
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 3..55
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 1..28
e-value: 2.2E-11
score: 42.7
coord: 29..57
e-value: 5.6E-8
score: 31.8
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 39..60
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 11..31
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 9..36
score: 12.071
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 37..60
score: 10.263

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq1983HiSeq1983Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq1983_p ID=HiSeq1983_p|Name=HiSeq1983|organism=Ostrinia scapulalis|type=polypeptide|length=155bp
RTHTGERPFPCDVCGLAFRRLTAMRNHRLIHTGVRAWACERCPKRFRIRS
DLRTHARLKHPAHLAVIEIRGLNPTPDEVMEYLNANNISHTKVIEITKMS
FAKGTSSIIPNCARALSMLGSVPRTQVTYSKPVIDDSDFQPPRRGRGIAK
NPRRP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003924GTPase activity
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0005525GTP binding
GO:0004871signal transducer activity
GO:0046872metal ion binding
GO:0003676nucleic acid binding
Vocabulary: Biological Process
TermDefinition
GO:0002376immune system process
GO:0030154cell differentiation
GO:0007186G-protein coupled receptor signaling pathway
GO:0048731system development
Vocabulary: INTERPRO
TermDefinition
IPR007087Znf_C2H2
IPR013087Znf_C2H2/integrase_DNA-bd
IPR015880Znf_C2H2-like