HiSeq20503_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq20503
Unique NameHiSeq20503_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length136
Homology
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|512928378|ref|XP_004931563.1| (PREDICTED: mpv17-like protein [Bombyx mori])

HSP 1 Score: 209.534 bits (532), Expect = 6.401e-67
Identity = 96/133 (72.18%), Postives = 114/133 (85.71%), Query Frame = 0
Query:    4 GSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK 136
             +AARIV  GSTVY   LY+WY+FLDK FAG A+K VA KVA++QFI TPILLA FYTL+G+LER+EDVFEEL++KY KT IANQAFWIP+QT+NF+F+P HLRVVYVA+ SFVWIN+LCFIKRQKN K  E+
Sbjct:   53 AAAARIVSVGSTVYAPTLYFWYKFLDKKFAGNAIKAVATKVASDQFIMTPILLATFYTLLGILERREDVFEELKQKYWKTFIANQAFWIPAQTINFYFMPSHLRVVYVASTSFVWINILCFIKRQKNMKKLEE 185          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|910336968|ref|XP_013172039.1| (PREDICTED: mpv17-like protein [Papilio xuthus] >gi|910336970|ref|XP_013172041.1| PREDICTED: mpv17-like protein [Papilio xuthus] >gi|910336972|ref|XP_013172042.1| PREDICTED: mpv17-like protein [Papilio xuthus] >gi|930654927|gb|KPI97259.1| Mpv17-like protein [Papilio xuthus])

HSP 1 Score: 201.06 bits (510), Expect = 1.335e-63
Identity = 93/134 (69.40%), Postives = 109/134 (81.34%), Query Frame = 0
Query:    1 MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVA 134
            + F +AARIV  GS VY   LY+WY+FLD+ F GTAVK VA KV  +QF+ TPILLAAFY L+G++ERKED+FEE++ KY KT IANQAFWIP QT+NFFFVP HLRVVYVA+ SF+WINVLCFIKRQK  K A
Sbjct:   50 LDFAAAARIVTVGSCVYAPTLYFWYKFLDRKFPGTAVKMVATKVMTDQFVMTPILLAAFYILMGIVERKEDIFEEIKAKYWKTFIANQAFWIPGQTINFFFVPTHLRVVYVASASFIWINVLCFIKRQKTEKTA 183          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|909581585|ref|XP_013146786.1| (PREDICTED: mpv17-like protein [Papilio polytes] >gi|909581587|ref|XP_013146788.1| PREDICTED: mpv17-like protein [Papilio polytes])

HSP 1 Score: 200.675 bits (509), Expect = 1.737e-63
Identity = 93/134 (69.40%), Postives = 108/134 (80.60%), Query Frame = 0
Query:    1 MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVA 134
            + F +AARIV  GS +Y   LY+WY+FLDK F GTAVK VA KV  +QF+ TP+LLAAFY L+G+ ERKED+FEE+R KY KT IANQAFWIP QT+NFFFVP HLRVVYVA+ SF+WINVLCFIKRQK  K A
Sbjct:   50 LDFSAAARIVTVGSCLYAPTLYFWYKFLDKKFVGTAVKMVATKVMTDQFVMTPVLLAAFYILMGIAERKEDIFEEIRVKYWKTFIANQAFWIPGQTINFFFVPSHLRVVYVASASFIWINVLCFIKRQKTEKTA 183          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|943975457|ref|XP_014368923.1| (PREDICTED: mpv17-like protein [Papilio machaon] >gi|930666161|gb|KPJ07284.1| Mpv17-like protein [Papilio machaon])

HSP 1 Score: 199.519 bits (506), Expect = 4.859e-63
Identity = 92/134 (68.66%), Postives = 108/134 (80.60%), Query Frame = 0
Query:    1 MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVA 134
            + F +AARIV  GS +Y   LY+WY+FLDK F GTAVK VA KV  +QF+ TP+LLAAFY L+G+ ERKED+FEE++ KY KT IANQAFWIP QT+NFFFVP HLRVVYVA+ SF+WINVLCFIKRQK  K A
Sbjct:   50 LDFAAAARIVTVGSCLYAPTLYFWYKFLDKKFVGTAVKMVATKVMTDQFVMTPVLLAAFYILMGIAERKEDIFEEIKAKYWKTFIANQAFWIPGQTINFFFVPSHLRVVYVASASFIWINVLCFIKRQKTEKTA 183          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|1073530495|gb|JAT82359.1| (hypothetical protein g.6713 [Pectinophora gossypiella])

HSP 1 Score: 196.823 bits (499), Expect = 1.185e-61
Identity = 92/136 (67.65%), Postives = 107/136 (78.68%), Query Frame = 0
Query:    1 MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK 136
            M + +AARIV  GS VY   L YWYR LD+ F GT +K VA KV ++QF+ TPILLAAFYT++ VLERKEDVFEELR KY KT +ANQ FWIP QT+NFFF+PPHLRVVYV+ VSF+WINVL FIKRQK  +  EK
Sbjct:   54 MNYAAAARIVTVGSCVYAPTLTYWYRLLDRKFTGTGLKAVATKVCSDQFLMTPILLAAFYTVLAVLERKEDVFEELRSKYWKTFVANQMFWIPGQTINFFFIPPHLRVVYVSVVSFLWINVLVFIKRQKVDEQIEK 189          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|1073540269|gb|JAT87246.1| (hypothetical protein g.6714 [Pectinophora gossypiella])

HSP 1 Score: 196.823 bits (499), Expect = 1.315e-61
Identity = 92/136 (67.65%), Postives = 107/136 (78.68%), Query Frame = 0
Query:    1 MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK 136
            M + +AARIV  GS VY   L YWYR LD+ F GT +K VA KV ++QF+ TPILLAAFYT++ VLERKEDVFEELR KY KT +ANQ FWIP QT+NFFF+PPHLRVVYV+ VSF+WINVL FIKRQK  +  EK
Sbjct:   49 MNYAAAARIVTVGSCVYAPTLTYWYRLLDRKFTGTGLKAVATKVCSDQFLMTPILLAAFYTVLAVLERKEDVFEELRSKYWKTFVANQMFWIPGQTINFFFIPPHLRVVYVSVVSFLWINVLVFIKRQKVDEQIEK 184          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|913319038|ref|XP_013190577.1| (PREDICTED: mpv17-like protein [Amyelois transitella])

HSP 1 Score: 194.897 bits (494), Expect = 4.060e-61
Identity = 88/128 (68.75%), Postives = 107/128 (83.59%), Query Frame = 0
Query:    5 SAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGK 132
            +AARI   GST+Y   LYYWY+FLD+ FAG A+KTV  KVAA+QF+ TP+LLA+F+T++ V+ERKED+F ELREKY    +ANQ+FWIP+Q VNF F+PPHLRVVYVAT SF+WINVLCFIKRQK GK
Sbjct:   54 AAARISAVGSTLYAPTLYYWYKFLDRKFAGKAMKTVITKVAADQFLMTPVLLASFFTIMSVVERKEDIFAELREKYWMAFMANQSFWIPAQMVNFSFMPPHLRVVYVATASFLWINVLCFIKRQKTGK 181          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|768411928|ref|XP_011566419.1| (PREDICTED: mpv17-like protein [Plutella xylostella] >gi|768411930|ref|XP_011566426.1| PREDICTED: mpv17-like protein [Plutella xylostella])

HSP 1 Score: 187.193 bits (474), Expect = 5.092e-58
Identity = 85/133 (63.91%), Postives = 102/133 (76.69%), Query Frame = 0
Query:    4 GSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK 136
             + ARI   GS++Y  +LYYWYRFLD+ F GTAVKT+ KKV  EQF  TPILLA FY L  +LE+KED+F+E REKY  +L ANQ FWIP+QTVNF F+P HLRVVYVA+ SF+WIN+LCFIKR+K     EK
Sbjct:   52 ATGARIACVGSSIYAPSLYYWYRFLDRKFVGTAVKTIGKKVVCEQFFMTPILLAVFYGLNAILEQKEDLFKEFREKYLISLAANQVFWIPAQTVNFTFIPSHLRVVYVASASFIWINILCFIKRRKVSNGGEK 184          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|357614926|gb|EHJ69372.1| (hypothetical protein KGM_17724 [Danaus plexippus])

HSP 1 Score: 179.874 bits (455), Expect = 3.217e-55
Identity = 81/132 (61.36%), Postives = 101/132 (76.52%), Query Frame = 0
Query:    1 MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGK 132
            + F +A RIV  GS +Y   LY+WY+FLD+ F GT +K V  KV  +Q I TPILLA FYT +G++ER+EDVF EL+ KY +T IANQA+WIP+QTVNF  +PP+LRVVYVA+ SF+WINVLCFIKRQ   K
Sbjct:   50 IDFAAAGRIVTVGSCLYAPTLYHWYKFLDRKFVGTTLKVVNTKVLCDQLIMTPILLAIFYTGMGIVERREDVFSELKAKYWRTFIANQAYWIPAQTVNFLLMPPNLRVVYVASASFIWINVLCFIKRQTTDK 181          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|914570825|gb|KOB74098.1| (putative peroxisomal membrane protein mpv17 [Operophtera brumata])

HSP 1 Score: 178.718 bits (452), Expect = 4.421e-55
Identity = 81/106 (76.42%), Postives = 94/106 (88.68%), Query Frame = 0
Query:   28 LDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKV 133
            L ++  GTAV+ VA KVAA+QFI TPILLA FYTL+GVLER+EDVFEELREKY KT +ANQAFWIP QT+NFFF+PPHLRVVYVA+ SF+WINVLC+IKRQKN K+
Sbjct:   57 LQQSLFGTAVRAVATKVAADQFIMTPILLATFYTLLGVLERREDVFEELREKYWKTFVANQAFWIPGQTINFFFMPPHLRVVYVASTSFIWINVLCYIKRQKNEKI 162          
The following BLAST results are available for this feature:
BLAST of HiSeq20503 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|512928378|ref|XP_004931563.1|6.401e-6772.18PREDICTED: mpv17-like protein [Bombyx mori][more]
gi|910336968|ref|XP_013172039.1|1.335e-6369.40PREDICTED: mpv17-like protein [Papilio xuthus] >gi... [more]
gi|909581585|ref|XP_013146786.1|1.737e-6369.40PREDICTED: mpv17-like protein [Papilio polytes] >g... [more]
gi|943975457|ref|XP_014368923.1|4.859e-6368.66PREDICTED: mpv17-like protein [Papilio machaon] >g... [more]
gi|1073530495|gb|JAT82359.1|1.185e-6167.65hypothetical protein g.6713 [Pectinophora gossypie... [more]
gi|1073540269|gb|JAT87246.1|1.315e-6167.65hypothetical protein g.6714 [Pectinophora gossypie... [more]
gi|913319038|ref|XP_013190577.1|4.060e-6168.75PREDICTED: mpv17-like protein [Amyelois transitell... [more]
gi|768411928|ref|XP_011566419.1|5.092e-5863.91PREDICTED: mpv17-like protein [Plutella xylostella... [more]
gi|357614926|gb|EHJ69372.1|3.217e-5561.36hypothetical protein KGM_17724 [Danaus plexippus][more]
gi|914570825|gb|KOB74098.1|4.421e-5576.42putative peroxisomal membrane protein mpv17 [Opero... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007248Mpv17/PMP22PFAMPF04117Mpv17_PMP22coord: 64..127
e-value: 1.7E-20
score: 72.2
IPR007248Mpv17/PMP22PANTHERPTHR11266PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 (MPV17)coord: 7..129
NoneNo IPR availablePANTHERPTHR11266:SF6SUBFAMILY NOT NAMEDcoord: 7..129
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 26..45
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 46..66
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 108..125
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 67..107
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..5
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 126..136
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 6..25
NoneNo IPR availableTMHMMTMhelixcoord: 49..66
NoneNo IPR availableTMHMMTMhelixcoord: 106..125
NoneNo IPR availableTMHMMTMhelixcoord: 6..28

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq20503HiSeq20503Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq20503_p ID=HiSeq20503_p|Name=HiSeq20503|organism=Ostrinia scapulalis|type=polypeptide|length=136bp
MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFI
ATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFF
FVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR007248Mpv17_PMP22