HiSeq20503_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq20503
Unique NameHiSeq20503_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length136
Homology
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|939639747|ref|XP_014270736.1| (PREDICTED: mpv17-like protein isoform X2 [Halyomorpha halys] >gi|939639750|ref|XP_014270737.1| PREDICTED: mpv17-like protein isoform X2 [Halyomorpha halys])

HSP 1 Score: 143.665 bits (361), Expect = 7.285e-41
Identity = 62/124 (50.00%), Postives = 87/124 (70.16%), Query Frame = 0
Query:    4 GSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKR 127
            G+  R  V GS V    LY+WY++LDK + GT  K + KK+  +QF+ TP LL AFY  + ++E KED+F+EL+EK+  T   +  FW+P+QT+NF F+PP  RV+YV T SF+WIN+LC+IKR
Sbjct:   51 GALVRYAVVGSGVNSNILYFWYKWLDKKYIGTGPKIIFKKLLLDQFVMTPQLLTAFYISMSIMEGKEDIFKELKEKFVPTFKRSCLFWLPAQTINFLFIPPVFRVMYVGTCSFIWINILCYIKR 174          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|939639744|ref|XP_014270735.1| (PREDICTED: mpv17-like protein isoform X1 [Halyomorpha halys])

HSP 1 Score: 143.665 bits (361), Expect = 8.889e-41
Identity = 62/124 (50.00%), Postives = 87/124 (70.16%), Query Frame = 0
Query:    4 GSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKR 127
            G+  R  V GS V    LY+WY++LDK + GT  K + KK+  +QF+ TP LL AFY  + ++E KED+F+EL+EK+  T   +  FW+P+QT+NF F+PP  RV+YV T SF+WIN+LC+IKR
Sbjct:   59 GALVRYAVVGSGVNSNILYFWYKWLDKKYIGTGPKIIFKKLLLDQFVMTPQLLTAFYISMSIMEGKEDIFKELKEKFVPTFKRSCLFWLPAQTINFLFIPPVFRVMYVGTCSFIWINILCYIKR 182          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|1048020017|ref|XP_017488175.1| (PREDICTED: mpv17-like protein [Rhagoletis zephyria] >gi|1048020019|ref|XP_017488177.1| PREDICTED: mpv17-like protein [Rhagoletis zephyria])

HSP 1 Score: 143.28 bits (360), Expect = 1.110e-40
Identity = 61/133 (45.86%), Postives = 89/133 (66.92%), Query Frame = 0
Query:    3 FGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAE 135
            + +  R  V G+TVY   LY WY++LD+TF GTA   + KK+  +QF+ TP LL  FYT + ++ER ED F+ELREK+  T + +  FW+P QT+NF  + P  RV+Y+    F+W+N+LC+IKRQ+N   +E
Sbjct:   55 YATIGRYAVMGTTVYAPTLYIWYKWLDRTFPGTAKPIIIKKLVLDQFVLTPYLLTVFYTGMSLMERAEDPFKELREKFVPTFLRSCTFWLPVQTLNFILIAPRFRVIYMGVCGFIWVNILCWIKRQRNELQSE 187          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|662208739|ref|XP_008477935.1| (PREDICTED: mpv17-like protein isoform X2 [Diaphorina citri])

HSP 1 Score: 141.354 bits (355), Expect = 3.170e-40
Identity = 60/123 (48.78%), Postives = 85/123 (69.11%), Query Frame = 0
Query:    7 ARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQK 129
             R  + G+ + P  LY+WY++LDK F G + + V KKV  +QF  TP L A FYT + ++E K+D+F ELREK+  T   +  FW+P+QT+NFFF+PP  RV++V T SFVWIN+LC++KR  
Sbjct:   32 GRYAILGTCINPNILYFWYKWLDKAFTGKSAQIVVKKVLIDQFCMTPPLYAIFYTSMSLMEGKDDIFAELREKFLPTFQTSCIFWLPAQTINFFFLPPAARVIFVGTCSFVWINILCWLKRSD 154          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|727830344|gb|JAC98090.1| (Mpv17-like protein [Bactrocera cucurbitae])

HSP 1 Score: 141.739 bits (356), Expect = 4.630e-40
Identity = 60/128 (46.88%), Postives = 88/128 (68.75%), Query Frame = 0
Query:    3 FGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKN 130
            + +  R  V G+TV+   LY WY++LD+TF GTA + + KK+  +QF+ TP LL  FYT + ++E+ ED F+ELREK+  T   +  FW+P+QT+NF  VPP  RV+Y+    F+W+N+LC+IKRQ N
Sbjct:   55 YATIGRYAVMGTTVFAPTLYTWYKWLDRTFPGTAKQIIVKKLVLDQFLLTPYLLTVFYTGMSLMEQAEDPFKELREKFVPTFARSCIFWLPAQTLNFVMVPPRFRVIYMGVCGFIWVNILCWIKRQPN 182          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|662208729|ref|XP_008477930.1| (PREDICTED: mpv17-like protein isoform X1 [Diaphorina citri] >gi|662208731|ref|XP_008477931.1| PREDICTED: mpv17-like protein isoform X1 [Diaphorina citri] >gi|662208733|ref|XP_008477932.1| PREDICTED: mpv17-like protein isoform X1 [Diaphorina citri] >gi|662208735|ref|XP_008477933.1| PREDICTED: mpv17-like protein isoform X1 [Diaphorina citri] >gi|662208737|ref|XP_008477934.1| PREDICTED: mpv17-like protein isoform X1 [Diaphorina citri])

HSP 1 Score: 141.354 bits (355), Expect = 5.870e-40
Identity = 60/123 (48.78%), Postives = 85/123 (69.11%), Query Frame = 0
Query:    7 ARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQK 129
             R  + G+ + P  LY+WY++LDK F G + + V KKV  +QF  TP L A FYT + ++E K+D+F ELREK+  T   +  FW+P+QT+NFFF+PP  RV++V T SFVWIN+LC++KR  
Sbjct:   52 GRYAILGTCINPNILYFWYKWLDKAFTGKSAQIVVKKVLIDQFCMTPPLYAIFYTSMSLMEGKDDIFAELREKFLPTFQTSCIFWLPAQTINFFFLPPAARVIFVGTCSFVWINILCWLKRSD 174          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|1058210952|gb|JAT08992.1| (hypothetical protein g.23138 [Graphocephala atropunctata] >gi|1058227736|gb|JAT17384.1| hypothetical protein g.23140 [Graphocephala atropunctata])

HSP 1 Score: 140.198 bits (352), Expect = 1.652e-39
Identity = 62/123 (50.41%), Postives = 85/123 (69.11%), Query Frame = 0
Query:    7 ARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQK 129
            AR  V G+ + P  LY+WYR+LD+ + GTA + V +K+  +QFI TP LL  FY  + ++E K+D+FEE R+K+  T   +  FW+P+Q +NF  VPP LRV YV T SFVWINVLC+IKR+ 
Sbjct:   55 ARYAVIGTVINPNLLYFWYRWLDRAYVGTATRIVLQKLFLDQFIMTPPLLVTFYLSMSLMEGKKDMFEECRQKFIPTFQTSCLFWLPAQLINFLMVPPFLRVAYVGTCSFVWINVLCWIKRKN 177          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|1048046475|ref|XP_017494767.1| (PREDICTED: mpv17-like protein [Rhagoletis zephyria])

HSP 1 Score: 138.272 bits (347), Expect = 1.813e-39
Identity = 58/123 (47.15%), Postives = 85/123 (69.11%), Query Frame = 0
Query:   13 GSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAE 135
            G+TVY   LY WY++LD+TF GTA   + KK+  +QF+ TP LL  FYT + ++ER +D F+ELREK+  T + +  FW+P QT+NF  + P  RV+Y+    F+W+N+LC+IKRQ+N   +E
Sbjct:    2 GTTVYAPTLYTWYKWLDRTFPGTAKPIIVKKLVLDQFVLTPYLLTVFYTGMSLMERAQDPFKELREKFVPTFLRSCIFWLPVQTLNFILIAPRFRVIYMGVCGFIWVNILCWIKRQRNELQSE 124          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|751438101|ref|XP_011176991.1| (PREDICTED: mpv17-like protein [Bactrocera cucurbitae])

HSP 1 Score: 140.198 bits (352), Expect = 1.925e-39
Identity = 59/128 (46.09%), Postives = 87/128 (67.97%), Query Frame = 0
Query:    3 FGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQKN 130
            + +  R  V G+TV+   LY WY++LD+TF GT  + + KK+  +QF+ TP LL  FYT + ++E+ ED F+ELREK+  T   +  FW+P+QT+NF  VPP  RV+Y+    F+W+N+LC+IKRQ N
Sbjct:   55 YATIGRYAVMGTTVFAPTLYTWYKWLDRTFPGTTKQIIVKKLVLDQFLLTPYLLTVFYTGMSLMEQAEDPFKELREKFVPTFARSCIFWLPAQTLNFVMVPPRFRVIYMGVCGFIWVNILCWIKRQPN 182          
BLAST of HiSeq20503 vs. genbank:protein
Match: gi|1058141050|gb|JAS74173.1| (hypothetical protein g.30383, partial [Homalodisca liturata] >gi|1058145982|gb|JAS76639.1| hypothetical protein g.30384, partial [Homalodisca liturata])

HSP 1 Score: 140.198 bits (352), Expect = 2.267e-39
Identity = 60/126 (47.62%), Postives = 85/126 (67.46%), Query Frame = 0
Query:    4 GSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFIATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFFFVPPHLRVVYVATVSFVWINVLCFIKRQK 129
            G  AR  V G+ + P  LY+WY++LD+ + GT  + V KK+  +QF+ TP LL  FY  + ++E K+D+FEE R+K+  T   +  FW+P+Q +NF  VPP  RVVYV T SF+WINVLC+IKR+ 
Sbjct:   63 GVLARYAVVGTVINPNLLYFWYKWLDRAYVGTTTRIVLKKLVLDQFLMTPPLLVTFYLSMSIMEGKKDIFEECRQKFIPTFQNSCLFWLPAQLINFLLVPPFARVVYVGTCSFIWINVLCWIKRKD 188          
The following BLAST results are available for this feature:
BLAST of HiSeq20503 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|939639747|ref|XP_014270736.1|7.285e-4150.00PREDICTED: mpv17-like protein isoform X2 [Halyomor... [more]
gi|939639744|ref|XP_014270735.1|8.889e-4150.00PREDICTED: mpv17-like protein isoform X1 [Halyomor... [more]
gi|1048020017|ref|XP_017488175.1|1.110e-4045.86PREDICTED: mpv17-like protein [Rhagoletis zephyria... [more]
gi|662208739|ref|XP_008477935.1|3.170e-4048.78PREDICTED: mpv17-like protein isoform X2 [Diaphori... [more]
gi|727830344|gb|JAC98090.1|4.630e-4046.88Mpv17-like protein [Bactrocera cucurbitae][more]
gi|662208729|ref|XP_008477930.1|5.870e-4048.78PREDICTED: mpv17-like protein isoform X1 [Diaphori... [more]
gi|1058210952|gb|JAT08992.1|1.652e-3950.41hypothetical protein g.23138 [Graphocephala atropu... [more]
gi|1048046475|ref|XP_017494767.1|1.813e-3947.15PREDICTED: mpv17-like protein [Rhagoletis zephyria... [more]
gi|751438101|ref|XP_011176991.1|1.925e-3946.09PREDICTED: mpv17-like protein [Bactrocera cucurbit... [more]
gi|1058141050|gb|JAS74173.1|2.267e-3947.62hypothetical protein g.30383, partial [Homalodisca... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007248Mpv17/PMP22PFAMPF04117Mpv17_PMP22coord: 64..127
e-value: 1.7E-20
score: 72.2
IPR007248Mpv17/PMP22PANTHERPTHR11266PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 (MPV17)coord: 7..129
NoneNo IPR availablePANTHERPTHR11266:SF6SUBFAMILY NOT NAMEDcoord: 7..129
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 26..45
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 46..66
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 108..125
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 67..107
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..5
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 126..136
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 6..25
NoneNo IPR availableTMHMMTMhelixcoord: 49..66
NoneNo IPR availableTMHMMTMhelixcoord: 106..125
NoneNo IPR availableTMHMMTMhelixcoord: 6..28

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq20503HiSeq20503Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq20503_p ID=HiSeq20503_p|Name=HiSeq20503|organism=Ostrinia scapulalis|type=polypeptide|length=136bp
MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFI
ATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFF
FVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR007248Mpv17_PMP22