HiSeq25422_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq25422
Unique NameHiSeq25422_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length172
Homology
BLAST of HiSeq25422 vs. genbank:protein
Match: gi|357629779|gb|EHJ78346.1| (hypothetical protein KGM_08037 [Danaus plexippus])

HSP 1 Score: 74.3294 bits (181), Expect = 2.087e-14
Identity = 35/88 (39.77%), Postives = 59/88 (67.05%), Query Frame = 0
Query:   82 EFMKDHMMTTLYFYKEMKRIKEQRSVKGPLRNMIEWLELPGREKEKKEVLDCYIEMRKRKAKEPGDIWKQYDTNNLVINTIRDPFNDG 169
            +F+K+H ++T+Y   E+ RIK   +VK  LR M+ +LE P +E +K+ VL  +  ++K + KE  +++K+   N+ +IN I+DPFNDG
Sbjct:    2 DFLKNHRVSTMYLLDEINRIKRDHAVKDELREMVTYLEQPDKEADKELVLTLFNSIKKERLKETFNVFKKV-PNSGIINVIKDPFNDG 88          
BLAST of HiSeq25422 vs. genbank:protein
Match: gi|930677550|gb|KPJ17607.1| (hypothetical protein RR48_07095 [Papilio machaon])

HSP 1 Score: 62.003 bits (149), Expect = 4.595e-9
Identity = 33/86 (38.37%), Postives = 52/86 (60.47%), Query Frame = 0
Query:   73 HNQRMKEINEFMKDHMMTTLYFYKEMKRIKEQRSVKGPLRNMIEWLELPGREKEKKEVLDCYIEMRKRKAKEPGDIWKQYDTNNLV 158
            H  ++K+I +F+K H ++  YF+ EM+RI  QR VK  LRNM+ + E       K ++L+ + +++  K + P DIW    TNNLV
Sbjct:   60 HEIKVKKICDFVKTHYLSAEYFFNEMRRIISQREVKDDLRNMVTFFE--ENPDLKPKILEAFRKIKLSKKRNPPDIW-SLQTNNLV 142          
The following BLAST results are available for this feature:
BLAST of HiSeq25422 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|357629779|gb|EHJ78346.1|2.087e-1439.77hypothetical protein KGM_08037 [Danaus plexippus][more]
gi|930677550|gb|KPJ17607.1|4.595e-938.37hypothetical protein RR48_07095 [Papilio machaon][more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq25422HiSeq25422Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq25422_p ID=HiSeq25422_p|Name=HiSeq25422|organism=Ostrinia scapulalis|type=polypeptide|length=172bp
MTTILLSSVTGKSREPSYGLSMRRERNPKIIIIVDSSNYRKYDYKMRNIA
RTLNAIEEDKKERKKAALVRKQHNQRMKEINEFMKDHMMTTLYFYKEMKR
IKEQRSVKGPLRNMIEWLELPGREKEKKEVLDCYIEMRKRKAKEPGDIWK
QYDTNNLVINTIRDPFNDGHKN
back to top