HiSeq28268_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq28268
Unique NameHiSeq28268_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length215
Homology
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|909570834|ref|XP_013140981.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-like [Papilio polytes])

HSP 1 Score: 335.88 bits (860), Expect = 5.308e-115
Identity = 170/215 (79.07%), Postives = 192/215 (89.30%), Query Frame = 0
Query:    1 MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEADSEEWQSPAPLVTFA 215
            MTTL+RK+ K HSKH+KLCEEWALAECEGEGWWREAR  +S   +VRYAG  PVERA+SAPATA+AVRSALH+ KA NKKLQRV LDIS+KGI+V+D +SQ++VLS+SIYRISYCSADAANARVFAVVEGK  +G+ E HVVHVFVCAR KQARALALSLAHAFNDAYQAWQANQ  SLQ++  +LAPWVRFP+ESDEEAD+E WQSPAPLVTFA
Sbjct:    1 MTTLIRKMLKTHSKHKKLCEEWALAECEGEGWWREAR-GASEQGEVRYAGAVPVERAASAPATAIAVRSALHTIKASNKKLQRVTLDISAKGILVTDVDSQQNVLSVSIYRISYCSADAANARVFAVVEGKKESGSEEDHVVHVFVCARAKQARALALSLAHAFNDAYQAWQANQASSLQANSKKLAPWVRFPDESDEEADNEHWQSPAPLVTFA 214          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|389609131|dbj|BAM18177.1| (unknown unsecreted protein [Papilio xuthus])

HSP 1 Score: 331.257 bits (848), Expect = 3.199e-113
Identity = 169/215 (78.60%), Postives = 191/215 (88.84%), Query Frame = 0
Query:    1 MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEADSEEWQSPAPLVTFA 215
            M TLLRK+ K HSKH+KLCEEWALAECEGEGWWREAR  +    +VRYAGV PVERA+SAPATALAVRSALH+ K+ NKKLQRV LDIS+KGI+V D +SQ++VLS+SIYRISYCSADAANARVFAVVEGK  +G+ E+HVVHVFVCAR KQARALALSLAHAFNDAYQAWQA Q  SLQ++  +LAPWVRFP+ESDEEAD+E+WQSPAPLVTFA
Sbjct:    1 MATLLRKMLKTHSKHKKLCEEWALAECEGEGWWREAR-GAGEQGEVRYAGVVPVERAASAPATALAVRSALHTIKSSNKKLQRVTLDISAKGILVIDVDSQQNVLSVSIYRISYCSADAANARVFAVVEGKKESGSEENHVVHVFVCARAKQARALALSLAHAFNDAYQAWQATQASSLQANSKKLAPWVRFPDESDEEADNEQWQSPAPLVTFA 214          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|917957683|ref|NP_001299794.1| (uncharacterized protein LOC106126591 [Papilio xuthus] >gi|389610035|dbj|BAM18629.1| unknown unsecreted protein [Papilio xuthus])

HSP 1 Score: 329.331 bits (843), Expect = 1.909e-112
Identity = 168/215 (78.14%), Postives = 190/215 (88.37%), Query Frame = 0
Query:    1 MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEADSEEWQSPAPLVTFA 215
            M TLLRK+ K HSKH+KLCEEWALAECEGEGWWREAR  +    +VRYAGV PVERA+SAPATALAVRSALH+ K+ NKKLQRV LDIS+KGI+V D +SQ++VLS+SIYRISYCSADAANARVFAVVEGK  +G+ E+HVVHV VCAR KQARALALSLAHAFNDAYQAWQA Q  SLQ++  +LAPWVRFP+ESDEEAD+E+WQSPAPLVTFA
Sbjct:    1 MATLLRKMLKTHSKHKKLCEEWALAECEGEGWWREAR-GAGEQGEVRYAGVVPVERAASAPATALAVRSALHTIKSSNKKLQRVTLDISAKGILVIDVDSQQNVLSVSIYRISYCSADAANARVFAVVEGKKESGSEENHVVHVLVCARAKQARALALSLAHAFNDAYQAWQATQASSLQANSKKLAPWVRFPDESDEEADNEQWQSPAPLVTFA 214          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|913303727|ref|XP_013200892.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-like [Amyelois transitella])

HSP 1 Score: 325.094 bits (832), Expect = 1.016e-110
Identity = 173/218 (79.36%), Postives = 192/218 (88.07%), Query Frame = 0
Query:    1 MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQS-SGMRLAPWVRFPEESDEE--ADSEEWQSPAPLVTFA 215
            MTTLLRK+W+ HSKH+KLCEEWALAECEGEGWWREAR+   G  DVRYAGVAPVERA+SAPATALAVRSALH+AK  NKKLQRVNLDIS KGI+V+DAESQE+V+S+SIYRISYCSADAANARVFAVVEG+  +G+ E+HV HVFVCARRKQARALALSLAHAFNDAYQ WQANQ  SL + SG R+ PWV+F EESDEE   D E+W SPAPLVTFA
Sbjct:    1 MTTLLRKMWRTHSKHKKLCEEWALAECEGEGWWREARDLGRGQSDVRYAGVAPVERAASAPATALAVRSALHTAKTMNKKLQRVNLDISPKGIIVTDAESQENVISLSIYRISYCSADAANARVFAVVEGRGGSGSGETHVAHVFVCARRKQARALALSLAHAFNDAYQEWQANQGSSLHNPSGNRVNPWVQFAEESDEELDGDGEQWDSPAPLVTFA 218          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|512906865|ref|XP_004926300.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-like [Bombyx mori])

HSP 1 Score: 314.309 bits (804), Expect = 1.621e-106
Identity = 156/215 (72.56%), Postives = 183/215 (85.12%), Query Frame = 0
Query:    1 MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEADSEEWQSPAPLVTFA 215
            M TLLRK+WKNHSKH+KL EEWALA+CEGEGWWRE R+ +S  MDVRYAG APVERA+SAPAT + VR+AL SAK   KK Q+VN+DI+ KGI+V+DAE++ +VL++SIY ISYCSAD AN+RVFAVVEG   N  ++SH+VHVFVC++RKQARALALSLAHAFNDAYQ WQANQ GS+ S+  R APWVRF EESDEE D E+WQSPAPLVTFA
Sbjct:    1 MATLLRKMWKNHSKHKKLSEEWALADCEGEGWWREVRDPNS-KMDVRYAGSAPVERAASAPATVIGVRTALQSAKTLKKKPQKVNVDINIKGIIVTDAETENNVLAVSIYSISYCSADVANSRVFAVVEGAKGNDENDSHIVHVFVCSQRKQARALALSLAHAFNDAYQLWQANQAGSMNSNAKRTAPWVRFQEESDEEIDEEDWQSPAPLVTFA 214          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|930660356|gb|KPJ02348.1| (Inhibitor of growth protein 4 [Papilio xuthus])

HSP 1 Score: 314.694 bits (805), Expect = 6.936e-104
Identity = 159/201 (79.10%), Postives = 179/201 (89.05%), Query Frame = 0
Query:   15 HRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEADSEEWQSPAPLVTFA 215
            H KLCEEWALAECEGEGWWREAR  +    +VRYAGV PVERA+SAPATALAVRSALH+ K+ NKKLQRV LDIS+KGI+V D +SQ++VLS+SIYRISYCSADAANARVFAVVEGK  +G+ E+HVVHVFVCAR KQARALALSLAHAFNDAYQAWQA Q  SLQ++  +LAPWVRFP+ESDEEAD+E+WQSPAPLVTFA
Sbjct:  206 HPKLCEEWALAECEGEGWWREAR-GAGEQGEVRYAGVVPVERAASAPATALAVRSALHTIKSSNKKLQRVTLDISAKGILVIDVDSQQNVLSVSIYRISYCSADAANARVFAVVEGKKESGSEENHVVHVFVCARAKQARALALSLAHAFNDAYQAWQATQASSLQANSKKLAPWVRFPDESDEEADNEQWQSPAPLVTFA 405          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|943949340|ref|XP_014357704.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-A-like [Papilio machaon] >gi|930675288|gb|KPJ15587.1| Low density lipoprotein receptor adapter protein 1-A [Papilio machaon])

HSP 1 Score: 285.419 bits (729), Expect = 3.060e-95
Identity = 148/190 (77.89%), Postives = 166/190 (87.37%), Query Frame = 0
Query:    1 MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWV 190
            MTTLLRK+ K HSKH+KLCEEWALAECEGEGWWREAR  +    +VRYAG  PVERA+SAPATALAVRSALH+ K+ NKKLQRV LDIS+KGI+V D +SQ++V S+SIYRISYCSADAANARVFAVVEGK  +G+ ESHVVHVFVCAR KQARALALSLAHAFNDAYQAWQANQ  SLQ++  +LAPWV
Sbjct:    1 MTTLLRKMLKTHSKHKKLCEEWALAECEGEGWWREAR-GAGEQGEVRYAGAVPVERAASAPATALAVRSALHTIKSSNKKLQRVTLDISAKGILVIDVDSQQNVFSVSIYRISYCSADAANARVFAVVEGKKESGSEESHVVHVFVCARAKQARALALSLAHAFNDAYQAWQANQASSLQANSKKLAPWV 189          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|910351690|ref|XP_013179768.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-like [Papilio xuthus])

HSP 1 Score: 284.648 bits (727), Expect = 2.617e-94
Identity = 156/199 (78.39%), Postives = 178/199 (89.45%), Query Frame = 0
Query:   17 KLCEEWALAECEGEGWWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEADSEEWQSPAPLVTFA 215
            +LCEEWALAECEGEGWWREAR  +    +VRYAGV PVERA+SAPATALAVRSALH+ K+ NKKLQRV LDIS+KGI+V D +SQ++VLS+SIYRISYCSADAANARVFAVVEGK  +G+ E+HVVHVFVCAR K+ARALALSLAHAFNDAYQAWQA Q  SLQ++  +LAPWVRFP+ESDEEAD+E+WQSPAPLVTFA
Sbjct:   47 ELCEEWALAECEGEGWWREAR-GAGEQGEVRYAGVVPVERAASAPATALAVRSALHTIKSSNKKLQRVTLDISAKGILVIDVDSQQNVLSVSIYRISYCSADAANARVFAVVEGKKESGSEENHVVHVFVCARAKRARALALSLAHAFNDAYQAWQATQASSLQANSKKLAPWVRFPDESDEEADNEQWQSPAPLVTFA 244          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|815899263|ref|XP_012250255.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-B-like isoform X1 [Bombus impatiens])

HSP 1 Score: 153.295 bits (386), Expect = 4.770e-42
Identity = 84/181 (46.41%), Postives = 116/181 (64.09%), Query Frame = 0
Query:    3 TLLRKIWKNHSKHRKLCEEWALA---EC-EGEG----WWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQ 175
            +  R +WK+ SKH+KLCEEWALA   EC EG G       E+ ++S     ++Y G   VE  SS  ATA A+++ +  AKA  KKLQRV+L +S KGI ++D  ++E  L +SIYRISYCSADAA+  VFA +    A   +E+   H F+C +RK A+ + L++A AFN AY+AWQ +Q
Sbjct:    2 SFFRGLWKSSSKHKKLCEEWALANSRECVEGSGSAGTTHDESEDASEARFTLKYLGSTLVETPSSEEATAEAIKTVITMAKASGKKLQRVSLAVSLKGIRMTDLATEEDQLQVSIYRISYCSADAAHDHVFAFI----ATNLNETMECHAFLCPKRKMAQTVTLTVAQAFNTAYEAWQLSQ 178          
BLAST of HiSeq28268 vs. genbank:protein
Match: gi|1070174964|ref|XP_018347203.1| (PREDICTED: low density lipoprotein receptor adapter protein 1-like isoform X1 [Trachymyrmex septentrionalis])

HSP 1 Score: 153.295 bits (386), Expect = 6.414e-42
Identity = 84/182 (46.15%), Postives = 115/182 (63.19%), Query Frame = 0
Query:    3 TLLRKIWKNHSKHRKLCEEWALA---EC-EGEG-----WWREARESSSGHMDVRYAGVAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAESQESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARRKQARALALSLAHAFNDAYQAWQANQ 175
            +  R +WK+ SKH+KLCEEWALA   EC EG G        E+ ++S     ++Y G   VE  SS  ATA A+++ +  AKA  KKLQRV+L +S KGI ++D  ++E  L +SIYRISYCSADA +  VFA +    A   +E+   H F+C +RK A+ + L++A AFN AYQAWQ +Q
Sbjct:    2 SFFRGLWKSSSKHKKLCEEWALANSRECVEGGGSTSTTHGEESEDASEARFTLKYLGSTLVETPSSEEATAEAIKTVITMAKASGKKLQRVSLAVSLKGIRMTDLATEEDQLQVSIYRISYCSADATHDHVFAFI----ATNLNETMECHAFLCPKRKMAQTVTLTVAQAFNTAYQAWQLSQ 179          
The following BLAST results are available for this feature:
BLAST of HiSeq28268 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909570834|ref|XP_013140981.1|5.308e-11579.07PREDICTED: low density lipoprotein receptor adapte... [more]
gi|389609131|dbj|BAM18177.1|3.199e-11378.60unknown unsecreted protein [Papilio xuthus][more]
gi|917957683|ref|NP_001299794.1|1.909e-11278.14uncharacterized protein LOC106126591 [Papilio xuth... [more]
gi|913303727|ref|XP_013200892.1|1.016e-11079.36PREDICTED: low density lipoprotein receptor adapte... [more]
gi|512906865|ref|XP_004926300.1|1.621e-10672.56PREDICTED: low density lipoprotein receptor adapte... [more]
gi|930660356|gb|KPJ02348.1|6.936e-10479.10Inhibitor of growth protein 4 [Papilio xuthus][more]
gi|943949340|ref|XP_014357704.1|3.060e-9577.89PREDICTED: low density lipoprotein receptor adapte... [more]
gi|910351690|ref|XP_013179768.1|2.617e-9478.39PREDICTED: low density lipoprotein receptor adapte... [more]
gi|815899263|ref|XP_012250255.1|4.770e-4246.41PREDICTED: low density lipoprotein receptor adapte... [more]
gi|1070174964|ref|XP_018347203.1|6.414e-4246.15PREDICTED: low density lipoprotein receptor adapte... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006020PTB/PI domainSMARTSM00462PTBcoord: 39..177
e-value: 1.0E-16
score: 71.5
IPR006020PTB/PI domainPFAMPF00640PIDcoord: 46..171
e-value: 3.1E-15
score: 56.2
IPR006020PTB/PI domainPROSITEPS01179PIDcoord: 46..169
score: 16.41
IPR011993Pleckstrin homology-like domainGENE3D2.30.29.30coord: 44..176
e-value: 1.2E-24
score: 86.2
NoneNo IPR availablePANTHERPTHR11232DISABLED/NUMB-RELATED ADAPTORcoord: 16..172
NoneNo IPR availablePANTHERPTHR11232:SF42SUBFAMILY NOT NAMEDcoord: 16..172
NoneNo IPR availableSUPERFAMILY50729PH domain-likecoord: 44..176

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq28268HiSeq28268Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq28268_p ID=HiSeq28268_p|Name=HiSeq28268|organism=Ostrinia scapulalis|type=polypeptide|length=215bp
MTTLLRKIWKNHSKHRKLCEEWALAECEGEGWWREARESSSGHMDVRYAG
VAPVERASSAPATALAVRSALHSAKAFNKKLQRVNLDISSKGIVVSDAES
QESVLSISIYRISYCSADAANARVFAVVEGKAANGASESHVVHVFVCARR
KQARALALSLAHAFNDAYQAWQANQEGSLQSSGMRLAPWVRFPEESDEEA
DSEEWQSPAPLVTFA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR011993PH-like_dom
IPR006020PTB/PI_dom