HiSeq28356_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq28356
Unique NameHiSeq28356_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length409
Homology
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|913296138|ref|XP_013183410.1| (PREDICTED: 4-coumarate--CoA ligase 1-like isoform X1 [Amyelois transitella])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 284/405 (70.12%), Postives = 332/405 (81.98%), Query Frame = 0
Query:    7 TIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFVNTKNAVEDVT--FLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            T+K + +I+ IIQ DG P    V+ Y +V    D + F+AE V+GWTD AYILYSSGTTGLPKGVML+HLNVLYSAA F N      ++    LT+VPWYHAYGLMSTIN L+ ++ L+YFSGFNP  YLNAIQ +K N+LLAVPPIVVFLAKSPLV KYDLSSV++V+CGAAPLS ETI++A K+LPSCLGI+QGYGMTETSLLAT DL     KPGS GYPVRGVKAKVVDL+T + LGA + GEIC+KGP++MKGYAGN AATRE+ D +GYL+TGDIG++D++GCFF+VDRLKELIKYKG QVPPAEVESVLL+HP V+E  VVGA DE AGELPTAFVVLKP  R   + ++DFAA RLS +KRLHGGVIFVE IPKNPSGKILRR L+QKL + KKSKL
Sbjct:  149 TLKSMKYIQKIIQFDGIPVDKSVLSYCQVKENIDEKYFEAEPVEGWTDVAYILYSSGTTGLPKGVMLSHLNVLYSAATFDNEDKVDSELVTRLLTVVPWYHAYGLMSTINNLMIRKVLIYFSGFNPQLYLNAIQTHKANMLLAVPPIVVFLAKSPLVEKYDLSSVYVVMCGAAPLSTETISEACKRLPSCLGIYQGYGMTETSLLATKDLIEMARKPGSAGYPVRGVKAKVVDLDTRRKLGANKKGEICIKGPIIMKGYAGNRAATREIFDEEGYLRTGDIGFFDDEGCFFIVDRLKELIKYKGSQVPPAEVESVLLQHPGVSECGVVGAPDEAAGELPTAFVVLKPGIRLEPRVLVDFAAQRLSPSKRLHGGVIFVEEIPKNPSGKILRRKLKQKLLQMKKSKL 553          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|913296141|ref|XP_013183419.1| (PREDICTED: 4-coumarate--CoA ligase 1-like isoform X2 [Amyelois transitella])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 284/405 (70.12%), Postives = 332/405 (81.98%), Query Frame = 0
Query:    7 TIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFVNTKNAVEDVT--FLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            T+K + +I+ IIQ DG P    V+ Y +V    D + F+AE V+GWTD AYILYSSGTTGLPKGVML+HLNVLYSAA F N      ++    LT+VPWYHAYGLMSTIN L+ ++ L+YFSGFNP  YLNAIQ +K N+LLAVPPIVVFLAKSPLV KYDLSSV++V+CGAAPLS ETI++A K+LPSCLGI+QGYGMTETSLLAT DL     KPGS GYPVRGVKAKVVDL+T + LGA + GEIC+KGP++MKGYAGN AATRE+ D +GYL+TGDIG++D++GCFF+VDRLKELIKYKG QVPPAEVESVLL+HP V+E  VVGA DE AGELPTAFVVLKP  R   + ++DFAA RLS +KRLHGGVIFVE IPKNPSGKILRR L+QKL + KKSKL
Sbjct:  142 TLKSMKYIQKIIQFDGIPVDKSVLSYCQVKENIDEKYFEAEPVEGWTDVAYILYSSGTTGLPKGVMLSHLNVLYSAATFDNEDKVDSELVTRLLTVVPWYHAYGLMSTINNLMIRKVLIYFSGFNPQLYLNAIQTHKANMLLAVPPIVVFLAKSPLVEKYDLSSVYVVMCGAAPLSTETISEACKRLPSCLGIYQGYGMTETSLLATKDLIEMARKPGSAGYPVRGVKAKVVDLDTRRKLGANKKGEICIKGPIIMKGYAGNRAATREIFDEEGYLRTGDIGFFDDEGCFFIVDRLKELIKYKGSQVPPAEVESVLLQHPGVSECGVVGAPDEAAGELPTAFVVLKPGIRLEPRVLVDFAAQRLSPSKRLHGGVIFVEEIPKNPSGKILRRKLKQKLLQMKKSKL 546          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|827542744|ref|XP_012544423.1| (PREDICTED: luciferin 4-monooxygenase-like [Bombyx mori])

HSP 1 Score: 493.041 bits (1268), Expect = 7.352e-170
Identity = 257/415 (61.93%), Postives = 313/415 (75.42%), Query Frame = 0
Query:    1 MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQ-AEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFVNTKNAVED---VTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDVEK--SKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
             K N    K LPFIK  +QL+G+P   G+  +S +L+  D   ++ A E +G  DTA+ILYSSGTTGLPKGVMLTHLN LY++  F + +  V D    T LTIVPWYHAYGLMSTIN ++ K   VY SGFNP +YL  IQ YK+N+LL VPPIVVFLAK+P+V K+DLSSV  + CGAAPL+ ETIN+  K+LP+C GIFQGYGMTETS+ AT D++ +    KPGSGGY + G++AKVV++ET + LG    GEIC KGP++MKGYA N+ AT E+ D +GYL TGDIGYYD+DGCFFVVDRLKELIKYKGHQV PA +E VLL+H  V E  VVGA DELAGELPTAFVV KP+   TE++++DF   RLS   RLHGG+IFV+ IPKN SGKILRRVL+Q++ E KKSKL
Sbjct:   67 FKRNLGVFKSLPFIKNFVQLNGSPVERGIQTFSSLLLPTDPNMYEPALEARG-DDTAFILYSSGTTGLPKGVMLTHLNALYTSEVFEHGELNVVDKSCYTLLTIVPWYHAYGLMSTINNVLLKNTSVYLSGFNPLQYLKCIQDYKVNVLLVVPPIVVFLAKAPIVGKFDLSSVNKIWCGAAPLNSETINETLKRLPNCEGIFQGYGMTETSVAATKDINKDGVVRKPGSGGYVLPGLRAKVVNIETRERLGPYCEGEICFKGPVIMKGYANNKKATAEITDDEGYLNTGDIGYYDDDGCFFVVDRLKELIKYKGHQVAPAIIERVLLQHSDVLECGVVGAPDELAGELPTAFVVPKPDVTLTERELLDFTNERLSSTSRLHGGIIFVKEIPKNASGKILRRVLKQRIAEMKKSKL 480          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|910334897|ref|XP_013170893.1| (PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio xuthus] >gi|910334899|ref|XP_013170894.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio xuthus] >gi|910334901|ref|XP_013170896.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio xuthus] >gi|910334903|ref|XP_013170897.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio xuthus] >gi|910334905|ref|XP_013170898.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio xuthus] >gi|910334907|ref|XP_013170899.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio xuthus] >gi|930649918|gb|KPI92264.1| Luciferin 4-monooxygenase [Papilio xuthus])

HSP 1 Score: 494.967 bits (1273), Expect = 1.167e-169
Identity = 248/412 (60.19%), Postives = 313/412 (75.97%), Query Frame = 0
Query:    1 MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFV-NTKNAVEDVTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDL--DVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            +K N +  K +  IKT IQ++G    + +VP++ V V  + + F   +VQG  DT Y+LYSSGTTGLPKGVMLTHLNVLY+A+N + ++  +     +LT+VPWYHAYGLM+TIN LI  + +VYF GF P KYL AI+KYK+N+L  VPP+++F AKSPLV KYD+SSV +  C AAPLS +TI    ++LP+C GI Q YGMTETS  AT D   D    KPGSGG P+ GV  KVVD++T K LG  + GEIC+KGP+VMKGY GN+AA R++MD +G++KTGDIGYYD DG FF+V+R+KELIKYKGHQVPPA VE V+L+HPAVAE  VVGA DE AGELPTAFVV+KP  + TE++++DF  T+LS+A +L GGVIFV  IPKNPSGKILRRVL+Q LQ+K K+KL
Sbjct:  133 LKQNLALYKEVGCIKTYIQMNGQAVDSDIVPFNEVYVKVEPQGFDTGDVQGAIDTLYLLYSSGTTGLPKGVMLTHLNVLYAASNLMSDSLESRSRTCYLTVVPWYHAYGLMTTINNLINGKMIVYFPGFFPEKYLQAIEKYKVNVLFTVPPMMIFFAKSPLVEKYDMSSVKLAWCAAAPLSTDTIRQVMRRLPNCKGILQAYGMTETSTAATKDPEDDATIHKPGSGGPPLPGVSVKVVDIKTRKRLGPLETGEICIKGPVVMKGYLGNDAANRDIMDDEGFIKTGDIGYYDHDGYFFIVERIKELIKYKGHQVPPAAVEGVVLQHPAVAECGVVGAPDEEAGELPTAFVVVKPGQKLTERELLDFTNTKLSRASQLRGGVIFVNEIPKNPSGKILRRVLKQTLQKKIKNKL 544          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|943941388|ref|XP_014372090.1| (PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio machaon] >gi|943941391|ref|XP_014372091.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio machaon])

HSP 1 Score: 488.034 bits (1255), Expect = 5.761e-167
Identity = 246/412 (59.71%), Postives = 311/412 (75.49%), Query Frame = 0
Query:    1 MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFV-NTKNAVEDVTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDVEKS--KPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            +K N +    +  IKT IQ++G P  +  +P++ + V  +++ F+  +VQG  DT Y+LYSSGTTGLPKGVMLTHLN LY+A+N + ++  +     +LT+VPWYHAYGLM+TIN LI  + +VYF GF P KYL AI+KYK+N+L  VPP+++F AKSPLV KYD+SSV    C AAPLS +TI    ++LP+C GI Q YGMTETS  AT D +   +  KPGSGG P+ GV  KVVD++T K LG  + GEIC+KGP+VMKGY GNEAA  ++MD +G+LKTGDIGYYD DG FF+V+R+KELIKYKG+QVPPA VE V+L+HP VAE  VVG  DE AGELPTAFVVLKP  + +EK+I+DF ATRLS+A +L GGVIFV  IPKNPSGKILRRVL+Q LQ+K K+KL
Sbjct:  133 LKQNLALYNEVGCIKTYIQMNGQPIDSDTIPFNNLYVKVESQGFETGDVQGAIDTLYLLYSSGTTGLPKGVMLTHLNSLYAASNLMSDSLESRSRTCYLTVVPWYHAYGLMTTINNLINGKMIVYFPGFFPEKYLQAIEKYKVNVLFTVPPMMIFFAKSPLVEKYDMSSVKQAWCAAAPLSTDTIRQVLRRLPNCKGILQAYGMTETSTAATKDPEDNATIHKPGSGGPPLPGVSVKVVDVKTRKRLGPLETGEICIKGPVVMKGYLGNEAANHDIMDDEGFLKTGDIGYYDHDGYFFIVERIKELIKYKGNQVPPAAVEGVVLQHPGVAECGVVGKPDEEAGELPTAFVVLKPGYKLSEKEILDFTATRLSRASQLRGGVIFVNEIPKNPSGKILRRVLKQTLQKKMKNKL 544          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|930678250|gb|KPJ18228.1| (Luciferin 4-monooxygenase [Papilio machaon])

HSP 1 Score: 478.789 bits (1231), Expect = 1.797e-165
Identity = 239/393 (60.81%), Postives = 301/393 (76.59%), Query Frame = 0
Query:   20 LDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFV-NTKNAVEDVTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDVEKS--KPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            ++G P  +  +P++ + V  +++ F+  +VQG  DT Y+LYSSGTTGLPKGVMLTHLN LY+A+N + ++  +     +LT+VPWYHAYGLM+TIN LI  + +VYF GF P KYL AI+KYK+N+L  VPP+++F AKSPLV KYD+SSV    C AAPLS +TI    ++LP+C GI Q YGMTETS  AT D +   +  KPGSGG P+ GV  KVVD++T K LG  + GEIC+KGP+VMKGY GNEAA  ++MD +G+LKTGDIGYYD DG FF+V+R+KELIKYKG+QVPPA VE V+L+HP VAE  VVG  DE AGELPTAFVVLKP  + +EK+I+DF ATRLS+A +L GGVIFV  IPKNPSGKILRRVL+Q LQ+K K+KL
Sbjct:    1 MNGQPIDSDTIPFNNLYVKVESQGFETGDVQGAIDTLYLLYSSGTTGLPKGVMLTHLNSLYAASNLMSDSLESRSRTCYLTVVPWYHAYGLMTTINNLINGKMIVYFPGFFPEKYLQAIEKYKVNVLFTVPPMMIFFAKSPLVEKYDMSSVKQAWCAAAPLSTDTIRQVLRRLPNCKGILQAYGMTETSTAATKDPEDNATIHKPGSGGPPLPGVSVKVVDVKTRKRLGPLETGEICIKGPVVMKGYLGNEAANHDIMDDEGFLKTGDIGYYDHDGYFFIVERIKELIKYKGNQVPPAAVEGVVLQHPGVAECGVVGKPDEEAGELPTAFVVLKPGYKLSEKEILDFTATRLSRASQLRGGVIFVNEIPKNPSGKILRRVLKQTLQKKMKNKL 393          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|909560677|ref|XP_013135437.1| (PREDICTED: luciferin 4-monooxygenase-like [Papilio polytes])

HSP 1 Score: 428.713 bits (1101), Expect = 4.256e-144
Identity = 223/414 (53.86%), Postives = 288/414 (69.57%), Query Frame = 0
Query:    1 MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFVNTKNAVED---VTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDL--DVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            +K N +  K    IKT IQ++G P  + +V ++ V V  + + F+  +VQG  D  Y+LYSSGTTGLPKGVMLTHLN LY+A+N ++  +++E    V +LT+VPWYHAYGLM+TIN L   + +VYF GF P +YL AI+KYK+N+L  VPP+++F  KSPLV KYD+SSV +  C AAPLS +TI    ++ P+C GI Q YGMTETS  AT D   D    KPGSGG P+ GV  KVVD+++ K LG  +NGEIC+KGP+VMKGY GNEAA R++MD +G++KTGDIGYYD DG FF+V+R+KELIKYKGHQ                               LPTAFVVLKP  + TEK+++DF ATRLS++ +L GG+IFV  IPKNPSGKILRRVL++ LQ+K K+KL
Sbjct:  133 LKQNLALYKQAGCIKTYIQMNGQPVDSDIVAFNNVYVKVEPQGFETGDVQGAVDALYLLYSSGTTGLPKGVMLTHLNSLYAASNLMS--DSLESRLRVCYLTVVPWYHAYGLMTTINNLTNGKMIVYFPGFFPEQYLQAIEKYKVNVLFTVPPMMIFFTKSPLVEKYDMSSVKLAWCAAAPLSTDTIRQVMRRFPNCKGILQAYGMTETSTAATKDPEDDATIHKPGSGGPPLPGVCVKVVDVKSRKRLGPLENGEICIKGPVVMKGYLGNEAANRDIMDDEGFIKTGDIGYYDHDGYFFIVERIKELIKYKGHQ-------------------------------LPTAFVVLKPGHQLTEKELLDFTATRLSRSSQLRGGIIFVNEIPKNPSGKILRRVLKESLQKKIKNKL 513          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|827542742|ref|XP_012544422.1| (PREDICTED: 4-coumarate--CoA ligase 1-like [Bombyx mori])

HSP 1 Score: 421.779 bits (1083), Expect = 4.309e-141
Identity = 217/409 (53.06%), Postives = 279/409 (68.22%), Query Frame = 0
Query:    1 MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLY--SAANFVNTKNAVEDVTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDV--EKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKK 405
            +K +    K +PFI  +IQL+G P    V  YS +LV  +   +   EV G TDT +I YSSGTTGLPKGVML+HLN LY  S+ +F  T+ +   + FL+I+P  H +GL S I+YL   + L+    ++P  YL AI++YK+N+L+ VPPI VFL+KS LV KYDLSSV  + CGAAPLS ET     +  P+C  I  GYGMTETS +     D    + K GS G+ V G+K KVVD+ T +TLG+ + GE+C+KGPLVMKGY  N+ A  ++ D +G+LKTGDIGYYD DGCF++VDRLKELIKYKGHQV PA +E VLL+H  V E  VVGA DELAGELPTAFVV KP+   TEK+++DF   RLS   R+ GG+ FV  IPK+ +GKILR+VL+  +  KK
Sbjct:  126 LKKHIDVFKSMPFINKLIQLNGEPVQHDVNSYSSLLVPTNPNTYVPVEVNG-TDTVFIFYSSGTTGLPKGVMLSHLNALYVSSSLDFGYTRESC--IRFLSILPMCHVFGLFSVIHYLGCNKLLILMV-YSPVDYLKAIEEYKVNLLIIVPPIAVFLSKSDLVQKYDLSSVTRIWCGAAPLSQETTVGVLRNFPNCQKIIHGYGMTETSFIIIKSYDTLDSEQKHGSCGHVVPGMKVKVVDINTRQTLGSYERGEVCVKGPLVMKGYMNNDQANVDIRDDEGFLKTGDIGYYDSDGCFYIVDRLKELIKYKGHQVAPAMIERVLLQHSDVLECGVVGAPDELAGELPTAFVVPKPDVTLTEKELLDFTNERLSPITRIRGGIYFVSEIPKSGTGKILRKVLKASVIAKK 530          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|827542746|ref|XP_012544424.1| (PREDICTED: luciferin 4-monooxygenase-like [Bombyx mori])

HSP 1 Score: 405.986 bits (1042), Expect = 8.620e-135
Identity = 211/409 (51.59%), Postives = 273/409 (66.75%), Query Frame = 0
Query:    1 MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLY--SAANFVNTKNAVEDVTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETS--LLATSDLDVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKK 405
            +K +    K + FI  +IQL+G P    V  Y  +LV  +   +   EV G TDT +I YSSGTTGLPKGVML+HLN LY  S+ +F  T+ +     FL+I+P  H +GL S I+YL   + L+    ++P  YL AI++YK+N+L+ VPPI VFL+KS LV KYD SSV  + CGAAPLS ET     +   +C  I QGYGMTETS  ++   D    + K GS G+ + G+K KVVD+ T +TLG+ + GE+C+KGPLVMKGY  N+ A  ++ D +G+LKTGDIGYYD DGCF++VDRLKELIKYKGHQV PA +E VLL+H  V E  VVGA DELAGEL TA VV KP+   TE++++DF   RLS   R+ GG+ FV  IPKN +GKILR+VL+  L   K
Sbjct:  133 LKKHIDVFKSMSFIHKLIQLNGEPVERDVNSYRSLLVPTNPNTYVPVEVNG-TDTVFIFYSSGTTGLPKGVMLSHLNALYVSSSLDFGYTRESC--TRFLSILPMCHIFGLFSAIHYLACNKLLISMV-YSPVDYLKAIEEYKVNVLIIVPPIAVFLSKSDLVQKYDFSSVTRIWCGAAPLSEETAVGVLRNFSNCQKIIQGYGMTETSFAIMKIYDTLDSEQKHGSCGHVIPGMKVKVVDINTRQTLGSYERGEVCVKGPLVMKGYMNNDQANEDIKDDEGFLKTGDIGYYDSDGCFYIVDRLKELIKYKGHQVAPAMIERVLLQHSDVLECGVVGAPDELAGELHTASVVPKPDVTLTERELLDFTNERLSPITRIRGGIFFVGEIPKNATGKILRKVLKANLIANK 537          
BLAST of HiSeq28356 vs. genbank:protein
Match: gi|827542778|ref|XP_012544434.1| (PREDICTED: 4-coumarate--CoA ligase 1-like [Bombyx mori])

HSP 1 Score: 385.185 bits (988), Expect = 1.280e-126
Identity = 209/413 (50.61%), Postives = 273/413 (66.10%), Query Frame = 0
Query:    5 YSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAA--DARAFQAEEVQGWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANF------VNTKNAVEDVTFLTIVPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPPIVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQGYGMTETSLLATSDLDVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNGEICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRLKELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLKPNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQKLQEKKKSKL 409
            Y + K L ++K II         G++ Y+ ++     +   F   +V G  DT  ++ SSGTTGLPKGVMLTH+N L   A++      V  K  V  VT L ++PW+HAYG ++T   +  K R+V+   F   K+L  IQ YKIN+   VPP+ VFLAK PLV KYDLSS+  V CGAAPLS E I  A  +      I QGYG+TE ++    DL     K GS G P  G+K KV+D+E+G+ LG  Q GE+ +K PL MKGY G++AA+  + DG+GY++TGDIGYYD+DG F++VDRLKELIKYKG QV PAE+E++LL+H  VA++ VVG  DELAGELP AFVV +PN+  TEK++I++ A++LS AK L GGVIF+  IPKN SGKILRR LR  L  K+KSKL
Sbjct:  135 YDSCKDLSYVKHIITFGDFDVIPGLM-YNDLMKKEHNNMEDFSLVDVNGVEDTVAVMCSSGTTGLPKGVMLTHVNFLTLCAHYKYYFDSVQEKKNVPIVTGLALIPWFHAYGFITTFALMAMKIRIVFLIRFEGEKFLETIQNYKINMTTIVPPLAVFLAKHPLVLKYDLSSLHEVWCGAAPLSSE-IQKAVTKRTGIDFIKQGYGLTEATMACCVDL-TSGEKVGSCGTPAPGMKIKVLDIESGEKLGVEQEGELWIKTPLRMKGYMGDKAASDALFDGEGYVRTGDIGYYDKDGFFYIVDRLKELIKYKGFQVAPAELEALLLQHSGVADAGVVGLPDELAGELPIAFVVPQPNSNVTEKELIEYVASKLSPAKHLRGGVIFINEIPKNASGKILRRELRTMLS-KQKSKL 543          
The following BLAST results are available for this feature:
BLAST of HiSeq28356 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913296138|ref|XP_013183410.1|0.000e+070.12PREDICTED: 4-coumarate--CoA ligase 1-like isoform ... [more]
gi|913296141|ref|XP_013183419.1|0.000e+070.12PREDICTED: 4-coumarate--CoA ligase 1-like isoform ... [more]
gi|827542744|ref|XP_012544423.1|7.352e-17061.93PREDICTED: luciferin 4-monooxygenase-like [Bombyx ... [more]
gi|910334897|ref|XP_013170893.1|1.167e-16960.19PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio... [more]
gi|943941388|ref|XP_014372090.1|5.761e-16759.71PREDICTED: 4-coumarate--CoA ligase 1-like [Papilio... [more]
gi|930678250|gb|KPJ18228.1|1.797e-16560.81Luciferin 4-monooxygenase [Papilio machaon][more]
gi|909560677|ref|XP_013135437.1|4.256e-14453.86PREDICTED: luciferin 4-monooxygenase-like [Papilio... [more]
gi|827542742|ref|XP_012544422.1|4.309e-14153.06PREDICTED: 4-coumarate--CoA ligase 1-like [Bombyx ... [more]
gi|827542746|ref|XP_012544424.1|8.620e-13551.59PREDICTED: luciferin 4-monooxygenase-like [Bombyx ... [more]
gi|827542778|ref|XP_012544434.1|1.280e-12650.61PREDICTED: 4-coumarate--CoA ligase 1-like [Bombyx ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
molecular_function GO:0003824 catalytic activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.40.50.980coord: 50..71
e-value: 4.1E-10
score: 39.2
NoneNo IPR availableGENE3D3.40.50.980coord: 72..211
e-value: 4.5E-37
score: 126.5
NoneNo IPR availableGENE3D3.30.300.30coord: 303..407
e-value: 7.0E-34
score: 116.0
NoneNo IPR availableGENE3D2.30.38.10coord: 221..297
e-value: 5.6E-26
score: 89.8
NoneNo IPR availablePANTHERPTHR24096FAMILY NOT NAMEDcoord: 12..408
NoneNo IPR availablePANTHERPTHR24096:SF144BCDNA.GH02901coord: 12..408
NoneNo IPR availableSUPERFAMILY56801Acetyl-CoA synthetase-likecoord: 8..403
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 49..306
e-value: 3.7E-70
score: 236.2
IPR025110AMP-binding enzyme C-terminal domainPFAMPF13193AMP-binding_Ccoord: 315..391
e-value: 4.3E-16
score: 59.5
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 58..69

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq28356HiSeq28356Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq28356_p ID=HiSeq28356_p|Name=HiSeq28356|organism=Ostrinia scapulalis|type=polypeptide|length=409bp
MKLNYSTIKVLPFIKTIIQLDGAPAAAGVVPYSRVLVAADARAFQAEEVQ
GWTDTAYILYSSGTTGLPKGVMLTHLNVLYSAANFVNTKNAVEDVTFLTI
VPWYHAYGLMSTINYLITKRRLVYFSGFNPHKYLNAIQKYKINILLAVPP
IVVFLAKSPLVSKYDLSSVWIVLCGAAPLSVETINDAKKQLPSCLGIFQG
YGMTETSLLATSDLDVEKSKPGSGGYPVRGVKAKVVDLETGKTLGARQNG
EICLKGPLVMKGYAGNEAATREMMDGDGYLKTGDIGYYDEDGCFFVVDRL
KELIKYKGHQVPPAEVESVLLEHPAVAESAVVGAADELAGELPTAFVVLK
PNARATEKDIIDFAATRLSQAKRLHGGVIFVEAIPKNPSGKILRRVLRQK
LQEKKKSKL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR020845AMP-binding_CS
IPR025110AMP-bd_C
IPR000873AMP-dep_Synth/Lig