HiSeq35273_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35273
Unique NameHiSeq35273_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length276
Homology
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|913300933|ref|XP_013199817.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X2 [Amyelois transitella])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 269/276 (97.46%), Postives = 272/276 (98.55%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVK+KP+PEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHN HS +H
Sbjct:  192 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKEKPTPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRAASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNLHSSSH 467          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|913300931|ref|XP_013199816.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X1 [Amyelois transitella])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 269/276 (97.46%), Postives = 272/276 (98.55%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVK+KP+PEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHN HS +H
Sbjct:  213 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKEKPTPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRAASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNLHSSSH 488          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|910332193|ref|XP_013169450.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X2 [Papilio xuthus])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 268/276 (97.10%), Postives = 271/276 (98.19%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLP ELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+TAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHN HS +H
Sbjct:  140 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPAPEQFVAMNRGINNGGDLPHELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNVHSSSH 415          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|910332189|ref|XP_013169448.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X1 [Papilio xuthus] >gi|910332191|ref|XP_013169449.1| PREDICTED: GTP exchange factor for ARFs 1 isoform X1 [Papilio xuthus])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/276 (97.10%), Postives = 271/276 (98.19%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLP ELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+TAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHN HS +H
Sbjct:  159 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPAPEQFVAMNRGINNGGDLPHELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNVHSSSH 434          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|512932189|ref|XP_004932484.1| (PREDICTED: cytohesin-1 isoform X2 [Bombyx mori])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 266/276 (96.38%), Postives = 272/276 (98.55%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVL+AFV+LHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+T EERDEWIECLRRSISHNPFYDMLAQRKKKAQH+ HSG+H
Sbjct:  140 EAVLKAFVDLHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPTPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATVEERDEWIECLRRSISHNPFYDMLAQRKKKAQHSGHSGSH 415          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|512932185|ref|XP_004932483.1| (PREDICTED: cytohesin-1 isoform X1 [Bombyx mori] >gi|827560792|ref|XP_012551259.1| PREDICTED: cytohesin-1 isoform X1 [Bombyx mori] >gi|827560794|ref|XP_012551260.1| PREDICTED: cytohesin-1 isoform X1 [Bombyx mori])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 266/276 (96.38%), Postives = 272/276 (98.55%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVL+AFV+LHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+T EERDEWIECLRRSISHNPFYDMLAQRKKKAQH+ HSG+H
Sbjct:  160 EAVLKAFVDLHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPTPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATVEERDEWIECLRRSISHNPFYDMLAQRKKKAQHSGHSGSH 435          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|768428771|ref|XP_011555537.1| (PREDICTED: cytohesin-1 isoform X2 [Plutella xylostella])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 266/276 (96.38%), Postives = 271/276 (98.19%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVL+AFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+T EERDEWIECLRRSISHNPFYDMLAQRKKKAQH+ HS +H
Sbjct:  140 EAVLKAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPTPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATVEERDEWIECLRRSISHNPFYDMLAQRKKKAQHSVHSNSH 415          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|768428769|ref|XP_011555536.1| (PREDICTED: cytohesin-1 isoform X1 [Plutella xylostella])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 266/276 (96.38%), Postives = 271/276 (98.19%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVL+AFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+T EERDEWIECLRRSISHNPFYDMLAQRKKKAQH+ HS +H
Sbjct:  160 EAVLKAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPTPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATVEERDEWIECLRRSISHNPFYDMLAQRKKKAQHSVHSNSH 435          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|909575311|ref|XP_013143385.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X2 [Papilio polytes])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 266/274 (97.08%), Postives = 270/274 (98.54%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSG 274
            EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLP ELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+TAEERDEWIECLRRSISHNPFYDMLAQRKKKAQH+AH+ 
Sbjct:  140 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPAPEQFVAMNRGINNGGDLPHELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHSAHAA 413          
BLAST of HiSeq35273 vs. genbank:protein
Match: gi|910332195|ref|XP_013169451.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X3 [Papilio xuthus])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 268/276 (97.10%), Postives = 271/276 (98.19%), Query Frame = 0
Query:    1 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINNGGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNAHSGAH 276
            EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKP+PEQFVAMNRGINNGGDLP ELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVR A DRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSA+TAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHN HS +H
Sbjct:  120 EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYCQLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPAPEQFVAMNRGINNGGDLPHELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRPASDRQRPHCLELYASGGADLIKACKTDSEGKVVEGKHTVYRMSAATAEERDEWIECLRRSISHNPFYDMLAQRKKKAQHNVHSSSH 395          
The following BLAST results are available for this feature:
BLAST of HiSeq35273 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913300933|ref|XP_013199817.1|0.000e+097.46PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|913300931|ref|XP_013199816.1|0.000e+097.46PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|910332193|ref|XP_013169450.1|0.000e+097.10PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|910332189|ref|XP_013169448.1|0.000e+097.10PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|512932189|ref|XP_004932484.1|0.000e+096.38PREDICTED: cytohesin-1 isoform X2 [Bombyx mori][more]
gi|512932185|ref|XP_004932483.1|0.000e+096.38PREDICTED: cytohesin-1 isoform X1 [Bombyx mori] >g... [more]
gi|768428771|ref|XP_011555537.1|0.000e+096.38PREDICTED: cytohesin-1 isoform X2 [Plutella xylost... [more]
gi|768428769|ref|XP_011555536.1|0.000e+096.38PREDICTED: cytohesin-1 isoform X1 [Plutella xylost... [more]
gi|909575311|ref|XP_013143385.1|0.000e+097.08PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|910332195|ref|XP_013169451.1|0.000e+097.10PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0032012 regulation of ARF protein signal transduction
molecular_function GO:0005086 ARF guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000904Sec7 domainSMARTSM00222Sec7coord: 1..121
e-value: 7.3E-39
score: 145.1
IPR000904Sec7 domainPFAMPF01369Sec7coord: 2..121
e-value: 1.3E-49
score: 168.3
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 3..119
score: 30.12
IPR000904Sec7 domainSUPERFAMILY48425Sec7 domaincoord: 2..129
IPR001849Pleckstrin homology domainSMARTSM00233PHcoord: 138..254
e-value: 1.5E-23
score: 94.2
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 139..252
e-value: 2.4E-22
score: 78.9
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 137..252
score: 17.842
IPR023394Sec7 domain, alpha orthogonal bundleGENE3D1.10.1000.11coord: 12..129
e-value: 7.2E-54
score: 180.6
IPR011993Pleckstrin homology-like domainGENE3D2.30.29.30coord: 137..257
e-value: 3.1E-43
score: 146.2
NoneNo IPR availablePANTHERPTHR10663:SF113CYTOHESIN-1coord: 3..266
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 3..266
NoneNo IPR availableSUPERFAMILY50729PH domain-likecoord: 136..258

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35273HiSeq35273Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35273_p ID=HiSeq35273_p|Name=HiSeq35273|organism=Ostrinia scapulalis|type=polypeptide|length=276bp
EAVLRAFVELHDFTDLILVQALRQFLWSFRLPGEAQKIDRMMECFAQRYC
QLNPDIFTNADTCYVLSFAIIMLNTSLHNPSVKDKPSPEQFVAMNRGINN
GGDLPQELLLSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGR
YKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVRCAHDRQRPHCL
ELYASGGADLIKACKTDSEGKVVEGKHTVYRMSASTAEERDEWIECLRRS
ISHNPFYDMLAQRKKKAQHNAHSGAH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0032012regulation of ARF protein signal transduction
Vocabulary: Molecular Function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
Vocabulary: INTERPRO
TermDefinition
IPR011993PH-like_dom
IPR023394Sec7_alpha_orthog
IPR001849PH_domain
IPR000904Sec7_dom