HiSeq35274_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35274
Unique NameHiSeq35274_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length143
Homology
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|1073541543|gb|JAT87883.1| (hypothetical protein g.16038, partial [Pectinophora gossypiella])

HSP 1 Score: 286.96 bits (733), Expect = 1.252e-96
Identity = 139/143 (97.20%), Postives = 142/143 (99.30%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            MIS+FENLSLGGNNAASNHGDPF+HTELTPEQQK LIDIRRRKTELLLEIQQLKDELGEVVAELEA+DGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL
Sbjct:    1 MISDFENLSLGGNNAASNHGDPFSHTELTPEQQKALIDIRRRKTELLLEIQQLKDELGEVVAELEAMDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|943956952|ref|XP_014361292.1| (PREDICTED: cytohesin-1 [Papilio machaon])

HSP 1 Score: 286.96 bits (733), Expect = 1.110e-94
Identity = 140/143 (97.90%), Postives = 141/143 (98.60%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            MISEFENLSLGGNN ASNH DPFTHTELTPEQQKTLI+IRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL
Sbjct:    1 MISEFENLSLGGNNTASNHADPFTHTELTPEQQKTLIEIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|909575311|ref|XP_013143385.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X2 [Papilio polytes])

HSP 1 Score: 286.96 bits (733), Expect = 3.948e-94
Identity = 140/143 (97.90%), Postives = 141/143 (98.60%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            MISEFENLSLGGNN ASNH DPFTHTELTPEQQKTLI+IRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL
Sbjct:    1 MISEFENLSLGGNNTASNHADPFTHTELTPEQQKTLIEIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|910332193|ref|XP_013169450.1| (PREDICTED: GTP exchange factor for ARFs 1 isoform X2 [Papilio xuthus])

HSP 1 Score: 281.567 bits (719), Expect = 4.429e-92
Identity = 138/143 (96.50%), Postives = 140/143 (97.90%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            MISEFENLSLGG+N ASNH DPFTHTELT EQQKTLI+IRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL
Sbjct:    1 MISEFENLSLGGSNTASNHADPFTHTELTAEQQKTLIEIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|768428771|ref|XP_011555537.1| (PREDICTED: cytohesin-1 isoform X2 [Plutella xylostella])

HSP 1 Score: 277.715 bits (709), Expect = 1.809e-90
Identity = 135/143 (94.41%), Postives = 139/143 (97.20%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            MIS+FENLSLGGNNA SNHGDPFTH ELT EQQK LIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQ+ECKQ+SKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERS+FNEAVL
Sbjct:    1 MISDFENLSLGGNNATSNHGDPFTHAELTQEQQKALIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQDECKQSSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSDFNEAVL 143          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|512932189|ref|XP_004932484.1| (PREDICTED: cytohesin-1 isoform X2 [Bombyx mori])

HSP 1 Score: 275.789 bits (704), Expect = 9.345e-90
Identity = 136/143 (95.10%), Postives = 137/143 (95.80%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            MISEFENLSL G N  +NH DPFTHTELT EQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL
Sbjct:    1 MISEFENLSLSGRNGPNNHTDPFTHTELTAEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|1183243839|ref|XP_020711395.1| (cytohesin-1 isoform X3 [Athalia rosae])

HSP 1 Score: 197.593 bits (501), Expect = 3.446e-59
Identity = 101/147 (68.71%), Postives = 118/147 (80.27%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDG----QEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            M  + + L   G N+ ++  D F+ TELTPEQQK LIDIRR+KTELLLEIQQLKDELGEVVAE+EA++G     +E K ++K KQ +IGRKKFNMDPKKGIEYL E+ LL  TPEDVAQFLHKGEGL+KTAIGDYLGER +FNE VL
Sbjct:    1 MWQDLDGLGGSGVNSGAHQVDQFSTTELTPEQQKILIDIRRKKTELLLEIQQLKDELGEVVAEMEAMEGGGLASDETKPSNKTKQTTIGRKKFNMDPKKGIEYLIEHNLLASTPEDVAQFLHKGEGLNKTAIGDYLGERHDFNERVL 147          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|939681220|ref|XP_014299423.1| (PREDICTED: cytohesin-1 [Microplitis demolitor])

HSP 1 Score: 196.823 bits (499), Expect = 7.974e-59
Identity = 102/148 (68.92%), Postives = 116/148 (78.38%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDG-----QEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            M  + + L+    N+ S   D F+ TELTPEQQK LIDIRR+KTELLLEIQQLKDELGEVVAE+EA+DG      E  K ++K KQ SIGRKKFNMDPKKGIEYL E+ LL  TPEDVAQFL+KGEGL+KTAIGDYLGER +FNE VL
Sbjct:    1 MWQDLDTLTSSAVNSGSQQVDQFSTTELTPEQQKILIDIRRKKTELLLEIQQLKDELGEVVAEMEAMDGGGFTVDESNKPSNKTKQTSIGRKKFNMDPKKGIEYLIEHNLLAPTPEDVAQFLYKGEGLNKTAIGDYLGERHDFNERVL 148          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|1061125700|ref|XP_017887999.1| (PREDICTED: cytohesin-1 isoform X6 [Ceratina calcarata])

HSP 1 Score: 194.512 bits (493), Expect = 5.394e-58
Identity = 101/147 (68.71%), Postives = 117/147 (79.59%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDG----QEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            M  + + L   G N+ ++  D F  TELTPE QK LIDIRR+KTELLLEIQQLKDELGEVVAE+EA++G     +E K ++KAKQ SIGRKKFNMDPKKGIEYL E+ LL  TPEDVAQFL+KGEGL+KTAIGDYLGER +FNE VL
Sbjct:    1 MWQDLDGLGGAGVNSGAHQVDQFGTTELTPEHQKILIDIRRKKTELLLEIQQLKDELGEVVAEMEAMEGGGLATDETKPSNKAKQTSIGRKKFNMDPKKGIEYLIEHNLLAATPEDVAQFLYKGEGLNKTAIGDYLGERHDFNERVL 147          
BLAST of HiSeq35274 vs. genbank:protein
Match: gi|1061125697|ref|XP_017887998.1| (PREDICTED: cytohesin-1 isoform X5 [Ceratina calcarata])

HSP 1 Score: 194.512 bits (493), Expect = 5.465e-58
Identity = 101/147 (68.71%), Postives = 117/147 (79.59%), Query Frame = 0
Query:    1 MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEIQQLKDELGEVVAELEALDG----QEECKQNSKAKQMSIGRKKFNMDPKKGIEYLYENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL 143
            M  + + L   G N+ ++  D F  TELTPE QK LIDIRR+KTELLLEIQQLKDELGEVVAE+EA++G     +E K ++KAKQ SIGRKKFNMDPKKGIEYL E+ LL  TPEDVAQFL+KGEGL+KTAIGDYLGER +FNE VL
Sbjct:    1 MWQDLDGLGGAGVNSGAHQVDQFGTTELTPEHQKILIDIRRKKTELLLEIQQLKDELGEVVAEMEAMEGGGLATDETKPSNKAKQTSIGRKKFNMDPKKGIEYLIEHNLLAATPEDVAQFLYKGEGLNKTAIGDYLGERHDFNERVL 147          
The following BLAST results are available for this feature:
BLAST of HiSeq35274 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1073541543|gb|JAT87883.1|1.252e-9697.20hypothetical protein g.16038, partial [Pectinophor... [more]
gi|943956952|ref|XP_014361292.1|1.110e-9497.90PREDICTED: cytohesin-1 [Papilio machaon][more]
gi|909575311|ref|XP_013143385.1|3.948e-9497.90PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|910332193|ref|XP_013169450.1|4.429e-9296.50PREDICTED: GTP exchange factor for ARFs 1 isoform ... [more]
gi|768428771|ref|XP_011555537.1|1.809e-9094.41PREDICTED: cytohesin-1 isoform X2 [Plutella xylost... [more]
gi|512932189|ref|XP_004932484.1|9.345e-9095.10PREDICTED: cytohesin-1 isoform X2 [Bombyx mori][more]
gi|1183243839|ref|XP_020711395.1|3.446e-5968.71cytohesin-1 isoform X3 [Athalia rosae][more]
gi|939681220|ref|XP_014299423.1|7.974e-5968.92PREDICTED: cytohesin-1 [Microplitis demolitor][more]
gi|1061125700|ref|XP_017887999.1|5.394e-5868.71PREDICTED: cytohesin-1 isoform X6 [Ceratina calcar... [more]
gi|1061125697|ref|XP_017887998.1|5.465e-5868.71PREDICTED: cytohesin-1 isoform X5 [Ceratina calcar... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0043547 positive regulation of GTPase activity
biological_process GO:0032012 regulation of ARF protein signal transduction
molecular_function GO:0005086 ARF guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 36..71
NoneNo IPR availableGENE3D1.10.220.20coord: 73..143
e-value: 3.1E-30
score: 103.5
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 27..143
NoneNo IPR availablePANTHERPTHR10663:SF123CYTOHESIN-2coord: 27..143
IPR000904Sec7 domainPFAMPF01369Sec7coord: 78..143
e-value: 8.2E-12
score: 45.0
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 71..143
score: 13.847
IPR000904Sec7 domainSUPERFAMILY48425Sec7 domaincoord: 76..143

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35274HiSeq35274Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35274_p ID=HiSeq35274_p|Name=HiSeq35274|organism=Ostrinia scapulalis|type=polypeptide|length=143bp
MISEFENLSLGGNNAASNHGDPFTHTELTPEQQKTLIDIRRRKTELLLEI
QQLKDELGEVVAELEALDGQEECKQNSKAKQMSIGRKKFNMDPKKGIEYL
YENGLLQRTPEDVAQFLHKGEGLSKTAIGDYLGERSEFNEAVL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0032012regulation of ARF protein signal transduction
Vocabulary: Molecular Function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
Vocabulary: INTERPRO
TermDefinition
IPR000904Sec7_dom