HiSeq35277_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35277
Unique NameHiSeq35277_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length102
Homology
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768433408|ref|XP_011558070.1| (PREDICTED: uncharacterized protein LOC105388792 [Plutella xylostella])

HSP 1 Score: 92.4337 bits (228), Expect = 1.107e-20
Identity = 37/61 (60.66%), Postives = 52/61 (85.25%), Query Frame = 0
Query:    9 LRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPVDA 69
            L+ G++V++KDK  PP+MW +GRIV+L PG DG++RVAD++T +GII+RAYNNIC LP+D 
Sbjct:  211 LQVGSLVLVKDKTQPPLMWLMGRIVQLHPGKDGVSRVADIETKRGIIQRAYNNICPLPLDC 271          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768409938|ref|XP_011555557.1| (PREDICTED: uncharacterized protein LOC105386641 [Plutella xylostella])

HSP 1 Score: 94.3597 bits (233), Expect = 1.701e-20
Identity = 37/60 (61.67%), Postives = 52/60 (86.67%), Query Frame = 0
Query:    9 LRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPVD 68
            L+ G++V++KDK  PP+MW +GRIV+L PG DG++RVAD++T +GII+RAYNNIC LP+D
Sbjct:  440 LQVGSLVLVKDKTQPPLMWLMGRIVQLHPGKDGVSRVADIETKRGIIQRAYNNICPLPLD 499          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768435955|ref|XP_011559438.1| (PREDICTED: uncharacterized protein LOC105389929 [Plutella xylostella])

HSP 1 Score: 94.3597 bits (233), Expect = 2.017e-20
Identity = 37/60 (61.67%), Postives = 52/60 (86.67%), Query Frame = 0
Query:    9 LRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPVD 68
            L+ G++V++KDK  PP+MW +GRIV+L PG DG++RVAD++T +GII+RAYNNIC LP+D
Sbjct:  655 LQVGSLVLVKDKTQPPLMWLMGRIVQLHPGKDGVSRVADIETKRGIIQRAYNNICPLPLD 714          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768437375|ref|XP_011560223.1| (PREDICTED: uncharacterized protein LOC105390591 isoform X3 [Plutella xylostella])

HSP 1 Score: 85.8853 bits (211), Expect = 4.586e-20
Identity = 34/60 (56.67%), Postives = 50/60 (83.33%), Query Frame = 0
Query:    9 LRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPVD 68
            L+  ++V+IKDK +PP++W LGRI+++ PG DGI RVA+++T KG IRR +NNICLLP++
Sbjct:   13 LKENSLVLIKDKMSPPLLWSLGRILKVYPGVDGINRVAEIKTKKGTIRRGWNNICLLPLE 72          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768414843|ref|XP_011547943.1| (PREDICTED: uncharacterized protein LOC105380138 [Plutella xylostella])

HSP 1 Score: 87.0409 bits (214), Expect = 2.356e-19
Identity = 34/60 (56.67%), Postives = 50/60 (83.33%), Query Frame = 0
Query:    9 LRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPVD 68
            L+  ++V+IKDK +PP++W LGRI+++ PG DGI RVA+++T KG IRR +NNICLLP++
Sbjct:  125 LKENSLVLIKDKMSPPLLWSLGRILKVYPGVDGINRVAEIKTKKGTIRRGWNNICLLPLE 184          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|943945329|ref|XP_014355925.1| (PREDICTED: uncharacterized protein LOC106708858 [Papilio machaon])

HSP 1 Score: 85.1149 bits (209), Expect = 2.091e-18
Identity = 33/59 (55.93%), Postives = 51/59 (86.44%), Query Frame = 0
Query:    8 KLRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLP 66
            +L+ G++V++K+KA PP++W LGR+++L PG+DG ARVA+++T +G IRRA+NNIC LP
Sbjct:  140 ELKLGSLVLVKEKALPPLLWCLGRVIQLYPGSDGTARVAELKTRRGTIRRAFNNICPLP 198          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768437373|ref|XP_011560222.1| (PREDICTED: uncharacterized protein LOC105390591 isoform X2 [Plutella xylostella])

HSP 1 Score: 87.8113 bits (216), Expect = 2.174e-18
Identity = 34/60 (56.67%), Postives = 50/60 (83.33%), Query Frame = 0
Query:    9 LRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPVD 68
            L+  ++V+IKDK +PP++W LGRI+++ PG DGI RVA+++T KG IRR +NNICLLP++
Sbjct:  311 LKENSLVLIKDKMSPPLLWSLGRILKVYPGVDGINRVAEIKTKKGTIRRGWNNICLLPLE 370          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|943935564|ref|XP_014362376.1| (PREDICTED: uncharacterized protein LOC106713976 [Papilio machaon])

HSP 1 Score: 84.7297 bits (208), Expect = 2.206e-18
Identity = 33/59 (55.93%), Postives = 51/59 (86.44%), Query Frame = 0
Query:    8 KLRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLP 66
            +L+ G++V++K+KA PP++W LGR+++L PG+DG ARVA+++T +G IRRA+NNIC LP
Sbjct:  140 ELKLGSLVLVKEKALPPLLWCLGRVIQLYPGSDGTARVAELKTRRGTIRRAFNNICPLP 198          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768435276|ref|XP_011559079.1| (PREDICTED: uncharacterized protein LOC105389633 [Plutella xylostella])

HSP 1 Score: 83.9593 bits (206), Expect = 2.327e-18
Identity = 34/60 (56.67%), Postives = 46/60 (76.67%), Query Frame = 0
Query:    8 KLRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPV 67
            +L  G +V++KD+  PP++W+LGRI+++ PG DGI RV DV T KG I+RAYNNIC LP 
Sbjct:  101 QLMEGTLVLVKDRTMPPLLWRLGRIIKVHPGTDGITRVVDVLTKKGTIQRAYNNICPLPT 160          
BLAST of HiSeq35277 vs. genbank:protein
Match: gi|768421169|ref|XP_011551384.1| (PREDICTED: uncharacterized protein LOC105383070 isoform X1 [Plutella xylostella])

HSP 1 Score: 82.8037 bits (203), Expect = 2.816e-18
Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 0
Query:    8 KLRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQTSKGIIRRAYNNICLLPV 67
            +L  G +V++KD+  PP++W LGRI+++ PG DGI RV DV T KG I+RAYNNIC LP 
Sbjct:   66 QLMEGTLVLVKDRTMPPLLWPLGRIIKVHPGTDGITRVVDVLTKKGTIQRAYNNICPLPT 125          
The following BLAST results are available for this feature:
BLAST of HiSeq35277 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|768433408|ref|XP_011558070.1|1.107e-2060.66PREDICTED: uncharacterized protein LOC105388792 [P... [more]
gi|768409938|ref|XP_011555557.1|1.701e-2061.67PREDICTED: uncharacterized protein LOC105386641 [P... [more]
gi|768435955|ref|XP_011559438.1|2.017e-2061.67PREDICTED: uncharacterized protein LOC105389929 [P... [more]
gi|768437375|ref|XP_011560223.1|4.586e-2056.67PREDICTED: uncharacterized protein LOC105390591 is... [more]
gi|768414843|ref|XP_011547943.1|2.356e-1956.67PREDICTED: uncharacterized protein LOC105380138 [P... [more]
gi|943945329|ref|XP_014355925.1|2.091e-1855.93PREDICTED: uncharacterized protein LOC106708858 [P... [more]
gi|768437373|ref|XP_011560222.1|2.174e-1856.67PREDICTED: uncharacterized protein LOC105390591 is... [more]
gi|943935564|ref|XP_014362376.1|2.206e-1855.93PREDICTED: uncharacterized protein LOC106713976 [P... [more]
gi|768435276|ref|XP_011559079.1|2.327e-1856.67PREDICTED: uncharacterized protein LOC105389633 [P... [more]
gi|768421169|ref|XP_011551384.1|2.816e-1856.67PREDICTED: uncharacterized protein LOC105383070 is... [more]

Pages

back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35277HiSeq35277Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35277_p ID=HiSeq35277_p|Name=HiSeq35277|organism=Ostrinia scapulalis|type=polypeptide|length=102bp
MEIFIXXKLRSGAMVIIKDKAAPPMMWQLGRIVRLIPGNDGIARVADVQT
SKGIIRRAYNNICLLPVDAVEEEASSTAGCMVAPHAFSASQDGGGTSGGY
NI
back to top