HiSeq35281_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35281
Unique NameHiSeq35281_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length514
Homology
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|827548875|ref|XP_004927118.2| (PREDICTED: zinc finger protein with KRAB and SCAN domains 8-like [Bombyx mori])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 334/522 (63.98%), Postives = 392/522 (75.10%), Query Frame = 0
Query:    7 MDFTKICRVCLDQTKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVNDGVKNETGDVLDFPP--IRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSND-------------DEKPKKKRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEGNKIMNVFDDVTRKITVNTGVKCEG 513
            ++   +CR+CL  +K+ FDIFT YY KRKTLYSEML+ CTK+KP +DDGLPR ICKDC RQLK+ YAFNLQCE SD +LR  +     S+   E N + ++      + +K E+  + D  P  + DED          +K +IK E D         D+ S W+A+D+ +L +    IK KK    + D             +++PK KRGRKK EK  G    P SK+PHQCD+CGK LST+SNLKAHKICHTD+RPYKC +CPATFRGHSALFQH+K+HT ETPYHCEYCPKQF RRTGLVNHIR+HTGEKLYSC ICFK FVQSAQLSIH+KRH GDK FLCQDCGKGFPIK+DL+VHQRIHNGEKPY+CHLCTKTFATSGNL+IH+RIHNKEVRYNC +CQRGFVTCSAYNVHLKRHKGQ+DYHCECGKTFYTSSALKQH+VVHTGEKKYQCKICERKFTQTSHL+RHFKRDH KP AP+PSS+ YK+++ E    + V+D        N  VKCEG
Sbjct:   13 LNLKTMCRICLQTSKQIFDIFTCYYVKRKTLYSEMLASCTKLKPIVDDGLPRGICKDCSRQLKKVYAFNLQCEKSDVELRNVI-----SQNGIELNSIPNQDIKQEYNELKRESDSLDDTKPSCVSDED---------GIKNDIKTEND--------EDNESNWDAEDDNLLLE---EIKSKKDDGTNLDHGDTPDIWLEKDINKRPKAKRGRKKKEK-NGLSATPISKMPHQCDVCGKILSTKSNLKAHKICHTDVRPYKCTECPATFRGHSALFQHKKVHTKETPYHCEYCPKQFSRRTGLVNHIRVHTGEKLYSCGICFKNFVQSAQLSIHVKRHMGDKPFLCQDCGKGFPIKSDLRVHQRIHNGEKPYSCHLCTKTFATSGNLAIHIRIHNKEVRYNCPVCQRGFVTCSAYNVHLKRHKGQKDYHCECGKTFYTSSALKQHRVVHTGEKKYQCKICERKFTQTSHLTRHFKRDHAKPGAPIPSSNQYKVILNENKSHLFVYDQ--NLAGNNADVKCEG 506          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|910339155|ref|XP_013173206.1| (PREDICTED: zinc finger protein 62 homolog [Papilio xuthus])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 335/525 (63.81%), Postives = 398/525 (75.81%), Query Frame = 0
Query:    7 MDFTKICRVCLDQ-TKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVND-GVKNE-------TGDVLDFPPIRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSND---DEKPKKKRGRKKI----EKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYK-IVIQEGNKIMNVFDDVTRKITVNTGVKCEGS 514
            MDF KICR+CL+   KE +DI+T+ Y K  TLY EML +CTK+ PS DDGLP+LICKDC RQLKRAY FN+QCE SD++LR +L             Q+++  K V  D  +K E        GDV+       ++   P++      + IK+E ++K E     D+ S W+ADD+ +L       ++K ++E  +D   D++PKKK+G++K     E +     +PESKLPHQC++CGKFLST+SNLKAHKICH+DLRPYKC  CP+ FRGHS L QH+KLHTGETPYHCEYCPK+F RRTGLVNHIRMHTGEKLYSCDICFK+FVQSAQLSIH+KRHKGDK +LCQDCGKGFPIKADLKVHQRIHNGEKPY+CH+C KTFATSGNLSIHVRIHNKEVRY CK CQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEK Y+CKIC+RKF+Q+SHL RHFKRDH K   PVPSS++YK IV+ E NK    FD   +++  N  VKCEGS
Sbjct:    1 MDFDKICRICLESDQKEKYDIYTNIYVKTNTLYVEMLLNCTKLNPSKDDGLPKLICKDCTRQLKRAYTFNIQCEESDKKLRSHLSH----------KQIINGWKEVTGDCSIKVEDFNEKIINGDVVSGL----QNTVKPVEDLIKSDDGIKLEPEYKIE-----DEDSCWDADDDNLLLK-----EIKSKRESIDDLNGDDQPKKKKGKRKRNADNETITDERHVPESKLPHQCEVCGKFLSTKSNLKAHKICHSDLRPYKCDKCPSAFRGHSTLNQHKKLHTGETPYHCEYCPKKFSRRTGLVNHIRMHTGEKLYSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHMCEKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAK-QIPVPSSNYYKLIVMPETNK--PTFDVFNQQMAPNENVKCEGS 498          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|943941915|ref|XP_014372306.1| (PREDICTED: zinc finger protein 660-like [Papilio machaon])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 327/518 (63.13%), Postives = 381/518 (73.55%), Query Frame = 0
Query:    7 MDFTKICRVCLDQ-TKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVND--------GVKNETGDVLDFPPIRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSNDDEKPKKKRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYK-IVIQEGNKIMNVFDDVTRKITVNTGVKCEGS 514
            MDF KICR+CL+   KE +DI+ + Y K  TLY EML +CTK+ P  DDGLP LICKDC RQLKRAY FN+QCE SD++LR +LK            Q+++  K V +D          K   GDV++      ++    ++      + IK+E ++K E     D+ S W+ADD+ +L      +K  K K  S D+E             +     +PESKLPHQC++CGKFLST+SNLKAHKICH+DLRPYKC  CP+ FRGHS L QH+KLHTGETPYHCEYCPK+F RRTGLVNHIRMHTGEKLYSCDICFK+FVQSAQLSIH+KRHKGDK +LCQDCGKGFPIKADLKVHQRIHNGEKPY+CH+C KTFATSGNLSIHVRIHNKEVRY CK CQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEK Y+CKIC+RKF+Q+SHL RHFKRDH K   PVPSS +YK IV+ E NK    FD   +++  N  VKCEGS
Sbjct:    1 MDFDKICRICLESDQKEKYDIYENIYVKTNTLYVEMLLNCTKLNPCKDDGLPNLICKDCTRQLKRAYTFNIQCEESDKKLRSHLKH----------KQIINGWKEVTDDCNIKVEDLNEKTINGDVVNGL----QNTVKTVEDLIKTNDGIKLEPEYKLE-----DEDSCWDADDDNLL------LKEIKSKRESIDNES------------ITDDGNVPESKLPHQCEVCGKFLSTKSNLKAHKICHSDLRPYKCDKCPSAFRGHSTLNQHKKLHTGETPYHCEYCPKKFSRRTGLVNHIRMHTGEKLYSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHMCEKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAK-QIPVPSSSYYKLIVMPEANK--QTFDVFNQQMAPNGNVKCEGS 478          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|930659195|gb|KPJ01294.1| (Zinc finger protein 726 [Papilio xuthus])

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 325/525 (61.90%), Postives = 386/525 (73.52%), Query Frame = 0
Query:    7 MDFTKICRVCLDQ-TKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVND-GVKNE-------TGDVLDFPPIRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSND---DEKPKKKRGRKKI----EKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYK-IVIQEGNKIMNVFDDVTRKITVNTGVKCEGS 514
            MDF KICR+CL+   KE +DI+T+ Y                  PS DDGLP+LICKDC RQLKRAY FN+QCE SD++LR +L             Q+++  K V  D  +K E        GDV+       ++   P++      + IK+E ++K E     D+ S W+ADD+ +L       ++K ++E  +D   D++PKKK+G++K     E +     +PESKLPHQC++CGKFLST+SNLKAHKICH+DLRPYKC  CP+ FRGHS L QH+KLHTGETPYHCEYCPK+F RRTGLVNHIRMHTGEKLYSCDICFK+FVQSAQLSIH+KRHKGDK +LCQDCGKGFPIKADLKVHQRIHNGEKPY+CH+C KTFATSGNLSIHVRIHNKEVRY CK CQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEK Y+CKIC+RKF+Q+SHL RHFKRDH K   PVPSS++YK IV+ E NK    FD   +++  N  VKCEGS
Sbjct:    1 MDFDKICRICLESDQKEKYDIYTNIY------------------PSKDDGLPKLICKDCTRQLKRAYTFNIQCEESDKKLRSHLSH----------KQIINGWKEVTGDCSIKVEDFNEKIINGDVVSGL----QNTVKPVEDLIKSDDGIKLEPEYKIE-----DEDSCWDADDDNLLLK-----EIKSKRESIDDLNGDDQPKKKKGKRKRNADNETITDERHVPESKLPHQCEVCGKFLSTKSNLKAHKICHSDLRPYKCDKCPSAFRGHSTLNQHKKLHTGETPYHCEYCPKKFSRRTGLVNHIRMHTGEKLYSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHMCEKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAK-QIPVPSSNYYKLIVMPETNK--PTFDVFNQQMAPNESVKCEGS 480          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|913317875|ref|XP_013189942.1| (PREDICTED: zinc finger protein 558-like [Amyelois transitella])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 316/511 (61.84%), Postives = 377/511 (73.78%), Query Frame = 0
Query:    7 MDFTKICRVCLDQTKETF-DIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVNDGVKNETGDVLDFPPIRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKR-KEPSNDDEKPKKKRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEG-NKIMNVFDDVTRKITVNTGVKCEGS 514
            M+F+++CR+CL   K+   D+FTSY  K+KT  SEMLS CTKIKP+ +DGLPR ICK C RQLK++Y F  QCE SD+QL+ +L       +  + NQ  D T   V +GV +   +V +     +EDI+    SD  +K+ +  E   K E     ++  ++   D++ +     ++ + +   E  N   K  +KR    I+          SK PHQCD+CGK LST+SNLKAHK+CHTD RPY+C DCPATFRGHSALFQH+K+HTGETPYHCEYCPKQF RRTGLVNHIR+HTGEKLYSCD+C K FVQ AQLSIH+KRHKGDK +LCQDCGKGFPIKADLKVHQRIHNGEKPY+CHLCTKTFATSGNLSIHVRIH +EVRYNC  C +GFVTCSA+NVHLKRHKGQRDY CECGKTFYTSSALKQHKVVHTGEKKYQCKICERKF+QTSHLSRHFKRDH+KPN PVPSS+++K VI+EG N + N F          + VKCE S
Sbjct:    1 MNFSELCRICLKSNKQLLLDMFTSYDVKKKTSLSEMLSICTKIKPNQEDGLPRQICKFCSRQLKKSYIFYQQCEASDKQLKFHL-------DNLQENQNTD-TNIKVENGVIDLEHNVSETIN-SNEDIT---TSDSGVKDEVN-EEKVKIELNHNENEDDSYWDADDDNIALENIKVTIGESCSEIENQKRKRGRKRKVLTIDNDPDNYSARPSKKPHQCDVCGKLLSTKSNLKAHKVCHTDQRPYQCADCPATFRGHSALFQHKKVHTGETPYHCEYCPKQFSRRTGLVNHIRIHTGEKLYSCDVCSKNFVQGAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHLCTKTFATSGNLSIHVRIHTREVRYNCPECHKGFVTCSAFNVHLKRHKGQRDYQCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFSQTSHLSRHFKRDHMKPNVPVPSSEYFKHVIREGENNVFNFFSQSA------SDVKCENS 492          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|930677956|gb|KPJ17964.1| (Zinc finger protein 726 [Papilio machaon])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 317/518 (61.20%), Postives = 369/518 (71.24%), Query Frame = 0
Query:    7 MDFTKICRVCLDQ-TKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVND--------GVKNETGDVLDFPPIRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSNDDEKPKKKRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYK-IVIQEGNKIMNVFDDVTRKITVNTGVKCEGS 514
            MDF KICR+CL+   KE +DI+ + Y                  P  DDGLP LICKDC RQLKRAY FN+QCE SD++LR +LK            Q+++  K V +D          K   GDV++      ++    ++      + IK+E ++K E     D+ S W+ADD+ +L      +K  K K  S D+E             +     +PESKLPHQC++CGKFLST+SNLKAHKICH+DLRPYKC  CP+ FRGHS L QH+KLHTGETPYHCEYCPK+F RRTGLVNHIRMHTGEKLYSCDICFK+FVQSAQLSIH+KRHKGDK +LCQDCGKGFPIKADLKVHQRIHNGEKPY+CH+C KTFATSGNLSIHVRIHNKEVRY CK CQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEK Y+CKIC+RKF+Q+SHL RHFKRDH K   PVPSS +YK IV+ E NK    FD   +++  N  VKCEGS
Sbjct:    1 MDFDKICRICLESDQKEKYDIYENIY------------------PCKDDGLPNLICKDCTRQLKRAYTFNIQCEESDKKLRSHLKH----------KQIINGWKEVTDDCNIKVEDLNEKTINGDVVNGL----QNTVKTVEDLIKTNDGIKLEPEYKLE-----DEDSCWDADDDNLL------LKEIKSKRESIDNES------------ITDDGNVPESKLPHQCEVCGKFLSTKSNLKAHKICHSDLRPYKCDKCPSAFRGHSTLNQHKKLHTGETPYHCEYCPKKFSRRTGLVNHIRMHTGEKLYSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHMCEKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAK-QIPVPSSSYYKLIVMPEANK--QTFDVFNQQMAPNGNVKCEGS 460          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|357624742|gb|EHJ75400.1| (putative zinc finger protein 836 [Danaus plexippus])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 298/477 (62.47%), Postives = 356/477 (74.63%), Query Frame = 0
Query:   41 MLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVNDGVKNETGDVLDFPPIRDEDISFPLDSDYNLKENIKIETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSNDDEKPKKKRGRKKIEKVE-------GADILP-------------ESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEGNKIMNVFD 497
            M+S CTKIKP  DD LPR+ICK+C RQLKR Y+FN+QCE SD+ L+ YL     +         ++     V+D +K+E  +V      ++E+ +  L  D +L+ ++K+E    +E  D     S W+A+D+ VL     ++K   ++  SND++  ++K     + K E         D LP             +SK+ HQCD+CGK LST+SNLKAHKICHTDLRPYKC  CP+ FRGHSALFQH+K+HTGETPYHCEYC KQF RRTGLVNHIR+HTGEKL++C ICFK FVQSAQLSIH+KRHKGDK++LCQ+CGKGFPIKADLKVHQR HNGEKPY+CHLC KTFATSGNLSIH+RIHNKEVRYNCK C RGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTG KKYQCKICERKF+QTSHLSRHF+RDH KPN P+P SD YKIV+ E NK  N+F+
Sbjct:    1 MISYCTKIKPKEDDRLPRIICKECSRQLKRCYSFNVQCEESDKTLKCYLNNILITPA-------LETDSKDVSDEIKSENVEV------KNENFNLMLREDNSLERDVKLEPFPTNEQDD-----SVWDAEDDNVLL-GEIKLKKTLKESISNDNKYWEQKNINNHLSKEERVLKVIINGDDLPKKKRGRKKKEYEADSKI-HQCDVCGKILSTKSNLKAHKICHTDLRPYKCEFCPSAFRGHSALFQHKKVHTGETPYHCEYCSKQFSRRTGLVNHIRVHTGEKLFNCTICFKNFVQSAQLSIHMKRHKGDKTYLCQECGKGFPIKADLKVHQRTHNGEKPYSCHLCDKTFATSGNLSIHIRIHNKEVRYNCKECHRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGIKKYQCKICERKFSQTSHLSRHFRRDHSKPNLPMPPSDHYKIVLPE-NKCGNLFN 456          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|768446455|ref|XP_011565168.1| (PREDICTED: zinc finger protein 436-like [Plutella xylostella])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 273/524 (52.10%), Postives = 355/524 (67.75%), Query Frame = 0
Query:    6 TMDFTKICRVCLDQTKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVNDGVKNETGDVLDFPPIRDEDIS--------FPLDSDYNLKENIKIETDFKDEAGDGY---------DDGSTWEADDNEVLQDAAFRIKVKKRKEPSNDDEKPKKKRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEGNKIMNVFDDVTRKITVNTGVKCE 512
            T+DF KICR+C++   +TFDIFTSY  KR  +YS+ML  C   KPS++DGLPRLICK+C + LKRA++F +QCE +D +LR YL +            +  E   +V +   N   D     P+ + D                  L E+IK+E    DE               + S WE++D+ VL      + VKK +    D+    +    K+  K +G      SK+PHQC+ CGKFLS RSNLKAHKI HTDLRP+KC DCPA+FR +S LFQHRK HTGETPY C+YCPK+FRRRTGLVNH+R+HTG++ +SC ICFK+F+Q+ QLS H+KRHKG+K+FLCQDCGKGFPI++DLK+HQRIH+GEKPY C LC KTFATSGNLS HVRIHN E+R++C  C +GFVT SA+NVH+KRHKG ++Y CECGK FYTSS LKQHKVVHTGEKKYQCK+C++KF+Q+ HL+RHFK+DH++ + P+P  + Y+ V+ +  K+    +    K+     VKCE
Sbjct:    2 TLDFQKICRLCMESDVDTFDIFTSYCPKRNIMYSQMLCSCITHKPSIEDGLPRLICKECAKNLKRAHSFIVQCEENDSKLRNYLAS------------IKTEDLDIVGNLEDNRGSDTKCVSPVHNNDTDENDVKEEITEAQKKGALNEDIKLEESKDDEEVQNDADDDDHAMDQEDSCWESEDDNVL------LVVKKERSQPEDEGTKIRPLKEKRSRKNKGL-----SKMPHQCEECGKFLSNRSNLKAHKISHTDLRPHKCVDCPASFRSYSGLFQHRKCHTGETPYCCDYCPKRFRRRTGLVNHVRIHTGDRQFSCTICFKSFIQNGQLSTHMKRHKGEKTFLCQDCGKGFPIQSDLKIHQRIHSGEKPYRCRLCPKTFATSGNLSTHVRIHNNEIRFHCPHCPKGFVTSSAFNVHVKRHKGIKEYPCECGKKFYTSSGLKQHKVVHTGEKKYQCKVCDKKFSQSGHLTRHFKKDHVRSDVPLPPPEQYRRVVTQ--KVSETEEYSLLKMAPELNVKCE 500          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|768420121|ref|XP_011550808.1| (PREDICTED: zinc finger protein 12-like [Plutella xylostella])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 273/524 (52.10%), Postives = 354/524 (67.56%), Query Frame = 0
Query:    6 TMDFTKICRVCLDQTKETFDIFTSYYAKRKTLYSEMLSDCTKIKPSLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYEPNQLMDETKHVVNDGVKNETGDVLDFPPIRDEDIS--------FPLDSDYNLKENIKIETDFKDEAGDGY---------DDGSTWEADDNEVLQDAAFRIKVKKRKEPSNDDEKPKKKRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEGNKIMNVFDDVTRKITVNTGVKCE 512
            T+DF KICR+C+    +TFDIFTSY  KR  +YS+ML  C   KP ++DGLPRLICK+C + LKRA++F +QCE +D +LR YL +            +  E   +V +  +N   D     P+ + D                  L E+IK+E    DE               + S WE++D+ VL      + VKK +    D+    +    KK  K +G      SK+PHQC+ CGKFLS RSNLKAHKI HTDLRP+KC DCPA+FR +S LFQHRK HTGETPY C+YCPK+FRRRTGLVNH+R+HTG++ +SC ICFK+F+Q+ QLS H+KRHKG+K+FLCQDCGKGFPI++DLK+HQRIH+GEKPY C LC KTFATSGNLS HVRIHN E+R++C  C +GFVT SA+NVH+KRHKG ++Y CECGK FYTSS LKQHKVVHTGEKKYQCK+C++KF+Q+ HL+RHFK+DH++ + P+P  + Y+ V+ +  K+    +    K+     VKCE
Sbjct:    2 TLDFQKICRLCMKSDVDTFDIFTSYCPKRNIMYSQMLCSCITHKPFIEDGLPRLICKECAKNLKRAHSFIVQCEENDSKLRNYLAS------------IKTEDLDIVGNLEENRGSDSKCVSPVHNNDTEENDVKEEITEAQKKGALDEDIKLEESKDDEEVQNDADDDDHAMDQEDSCWESEDDNVL------LVVKKERSQPEDEGTKIRPLKEKKSRKNKGL-----SKMPHQCEECGKFLSNRSNLKAHKISHTDLRPHKCVDCPASFRSYSGLFQHRKCHTGETPYCCDYCPKRFRRRTGLVNHVRIHTGDRQFSCTICFKSFIQNGQLSTHMKRHKGEKTFLCQDCGKGFPIQSDLKIHQRIHSGEKPYRCRLCPKTFATSGNLSTHVRIHNNEIRFHCPHCPKGFVTSSAFNVHVKRHKGIKEYPCECGKKFYTSSGLKQHKVVHTGEKKYQCKVCDKKFSQSGHLTRHFKKDHVRSDVPLPPPEQYRRVVTQ--KVSETEEYSLLKMAPELNVKCE 500          
BLAST of HiSeq35281 vs. genbank:protein
Match: gi|909568178|ref|XP_013139533.1| (PREDICTED: zinc finger protein 239-like [Papilio polytes])

HSP 1 Score: 354.369 bits (908), Expect = 1.011e-117
Identity = 173/215 (80.47%), Postives = 190/215 (88.37%), Query Frame = 0
Query:  300 MHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKICERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEGNKIMNVFDDVTRKITVNTGVKCEGS 514
            MHTGEKLYSCDICFK+FVQSAQLSIH+KRHKGDK +LCQDCGKGFPIKADLKVHQRIHNGEKPY+CHLC KTFATSGNLSIHVRIHNKEVRY CK CQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEK Y+CKIC+RKF+Q+SHL RHFKRDH K   PVP++ +  I + E NK  +VF+   +++  N  VKCEGS
Sbjct:    1 MHTGEKLYSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHLCDKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAK-QIPVPANYYKLISMPETNKPFDVFN---QQMAPNESVKCEGS 211          

HSP 2 Score: 119.398 bits (298), Expect = 1.782e-27
Identity = 68/168 (40.48%), Postives = 88/168 (52.38%), Query Frame = 0
Query:  245 HTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGFVTCSAYNVHLKR 412
            HT  + Y C  C  +F   + L  H K H G+ PY C+ C K F  +  L  H R+H GEK YSC +C KTF  S  LSIH++ H  +  + C++C +GF   +   VH + H G++ Y C  C KTF TS  L  H  +H  E  Y CKIC R F   S    H KR
Sbjct:    2 HTGEKLYSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHLCDKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCE-CGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKR 168          

HSP 3 Score: 115.546 bits (288), Expect = 4.094e-26
Identity = 63/168 (37.50%), Postives = 89/168 (52.98%), Query Frame = 0
Query:  223 HQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVHQRIHNGEKPYACHLCTKTFATSGNLSIHV-RIHNKEV 389
            + CDIC K     + L  H   H   +PY C DC   F   + L  H+++H GE PY C  C K F     L  H+R+H  E  Y C  C + FV  +  ++H+KRHKG + + C +CGK F   + LK H+ +H GEK Y C +C + F+ S +L  H  R H K++
Sbjct:    8 YSCDICFKSFVQSAQLSIHMKRHKGDKPYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHLCDKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHC-ECGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAKQI 174          

HSP 4 Score: 75.8702 bits (185), Expect = 3.522e-12
Identity = 46/142 (32.39%), Postives = 71/142 (50.00%), Query Frame = 0
Query:  222 PHQCDICGKFLSTRSNLKAHKICHTDLRPYKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRMHTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADLKVH-QRIHNGEKP 362
            P+ C  CGK    +++LK H+  H   +PY C  C  TF     L  H ++H  E  Y C+ C + F   +    H++ H G++ Y C+ C KTF  S+ L  H   H G+K++ C+ C + F   + L  H +R H  + P
Sbjct:   35 PYLCQDCGKGFPIKADLKVHQRIHNGEKPYSCHLCDKTFATSGNLSIHVRIHNKEVRYKCKECQRGFVTCSAYNVHLKRHKGQRDYHCE-CGKTFYTSSALKQHKVVHTGEKNYKCKICDRKFSQSSHLGRHFKRDHAKQIP 175          
The following BLAST results are available for this feature:
BLAST of HiSeq35281 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827548875|ref|XP_004927118.2|0.000e+063.98PREDICTED: zinc finger protein with KRAB and SCAN ... [more]
gi|910339155|ref|XP_013173206.1|0.000e+063.81PREDICTED: zinc finger protein 62 homolog [Papilio... [more]
gi|943941915|ref|XP_014372306.1|0.000e+063.13PREDICTED: zinc finger protein 660-like [Papilio m... [more]
gi|930659195|gb|KPJ01294.1|0.000e+061.90Zinc finger protein 726 [Papilio xuthus][more]
gi|913317875|ref|XP_013189942.1|0.000e+061.84PREDICTED: zinc finger protein 558-like [Amyelois ... [more]
gi|930677956|gb|KPJ17964.1|0.000e+061.20Zinc finger protein 726 [Papilio machaon][more]
gi|357624742|gb|EHJ75400.1|0.000e+062.47putative zinc finger protein 836 [Danaus plexippus... [more]
gi|768446455|ref|XP_011565168.1|0.000e+052.10PREDICTED: zinc finger protein 436-like [Plutella ... [more]
gi|768420121|ref|XP_011550808.1|0.000e+052.10PREDICTED: zinc finger protein 12-like [Plutella x... [more]
gi|909568178|ref|XP_013139533.1|1.011e-11780.47PREDICTED: zinc finger protein 239-like [Papilio p... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0046872 metal ion binding
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012934Zinc finger, AD-typeSMARTSM00868zf-ADcoord: 12..88
e-value: 7.7E-7
score: 38.7
IPR012934Zinc finger, AD-typePFAMPF07776zf-ADcoord: 12..87
e-value: 9.9E-15
score: 54.1
IPR015880Zinc finger, C2H2-likeSMARTSM00355ZnF_C2H2coord: 335..357
e-value: 0.021
score: 24.0
coord: 307..329
e-value: 0.012
score: 24.8
coord: 251..273
e-value: 0.02
score: 24.1
coord: 391..413
e-value: 0.071
score: 22.2
coord: 363..385
e-value: 0.0017
score: 27.6
coord: 446..469
e-value: 0.03
score: 23.5
coord: 419..440
e-value: 12.0
score: 12.7
coord: 279..301
e-value: 3.1E-4
score: 30.1
coord: 223..245
e-value: 0.057
score: 22.6
IPR007087Zinc finger, C2H2PFAMPF00096zf-C2H2coord: 391..413
e-value: 0.015
score: 15.5
coord: 223..242
e-value: 0.0027
score: 17.8
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 393..413
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 253..273
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 337..357
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 225..245
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 365..385
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 309..329
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 448..469
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 281..301
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 419..445
score: 12.674
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 446..474
score: 11.468
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 251..278
score: 14.066
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 363..390
score: 12.154
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 335..362
score: 16.332
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 223..250
score: 12.258
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 279..306
score: 14.648
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 391..418
score: 11.261
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 307..334
score: 12.799
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 222..252
e-value: 2.0E-9
score: 36.8
coord: 253..280
e-value: 3.2E-10
score: 39.4
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 332..354
e-value: 1.8E-10
score: 40.0
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 301..331
e-value: 1.9E-12
score: 46.1
coord: 437..466
e-value: 8.5E-11
score: 40.8
coord: 406..436
e-value: 3.9E-9
score: 35.5
coord: 355..388
e-value: 1.8E-16
score: 59.0
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 281..300
e-value: 1.1E-10
score: 40.7
NoneNo IPR availablePFAMPF13465zf-H2C2_2coord: 294..317
e-value: 4.9E-7
score: 29.6
coord: 266..289
e-value: 3.6E-6
score: 26.8
coord: 432..456
e-value: 1.4E-6
score: 28.1
coord: 349..374
e-value: 7.6E-7
score: 29.0
NoneNo IPR availablePANTHERPTHR24409FAMILY NOT NAMEDcoord: 222..469
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 359..401
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 315..372
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 413..464
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 222..273
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 259..316
NoneNo IPR availableSUPERFAMILY57716Glucocorticoid receptor-like (DNA-binding domain)coord: 11..88

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35281HiSeq35281Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35281_p ID=HiSeq35281_p|Name=HiSeq35281|organism=Ostrinia scapulalis|type=polypeptide|length=514bp
MVHHSTMDFTKICRVCLDQTKETFDIFTSYYAKRKTLYSEMLSDCTKIKP
SLDDGLPRLICKDCCRQLKRAYAFNLQCENSDEQLRKYLKTPCKSEEKYE
PNQLMDETKHVVNDGVKNETGDVLDFPPIRDEDISFPLDSDYNLKENIKI
ETDFKDEAGDGYDDGSTWEADDNEVLQDAAFRIKVKKRKEPSNDDEKPKK
KRGRKKIEKVEGADILPESKLPHQCDICGKFLSTRSNLKAHKICHTDLRP
YKCGDCPATFRGHSALFQHRKLHTGETPYHCEYCPKQFRRRTGLVNHIRM
HTGEKLYSCDICFKTFVQSAQLSIHIKRHKGDKSFLCQDCGKGFPIKADL
KVHQRIHNGEKPYACHLCTKTFATSGNLSIHVRIHNKEVRYNCKICQRGF
VTCSAYNVHLKRHKGQRDYHCECGKTFYTSSALKQHKVVHTGEKKYQCKI
CERKFTQTSHLSRHFKRDHIKPNAPVPSSDFYKIVIQEGNKIMNVFDDVT
RKITVNTGVKCEGS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0008270zinc ion binding
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2/integrase_DNA-bd
IPR007087Znf_C2H2
IPR015880Znf_C2H2-like
IPR012934Znf_AD