HiSeq35283_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35283
Unique NameHiSeq35283_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length717
Homology
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|913306821|ref|XP_013183863.1| (PREDICTED: putative elongator complex protein 1 isoform X1 [Amyelois transitella])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 481/719 (66.90%), Postives = 606/719 (84.28%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPR--STVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSK-LEGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF VACPKFS+L I +TLY+LGLSHK  L +NG+VI++ VSS+F+HTHFLLITTLQH+LLC ELT+ G+ AI +YQ  ES+  +YKRKIERG KLV+AV NDTRT+FQMPRGNLE IQPRPLSLK+IG+YL+  +Y++AFDLMRKQRINLNLI+DH+P KF   ID FL  I+N SWL+LFLSDLEN+DVTKTMYASSY +K    +   ++K+H +CD++RSHL +R D D KI+ L+TT+VKKNT EDLE+AL ++K+LK +E+ GSKL +GSD+A+KYLLYMVDVN+LF++ALGMYDF LVLL+A+KSQKDPKEYIPMLNELN+M+ENYK+FSINK+LKRFS+AV+ LV CGPEK++EL+T VKYHSLY +AL  F    DIYK+IS+DFG +L+LKKQ + AG+++ERA ++EKA+ECYK+ALEWELAI++ + +  +D F++LC DLVN LKEEKR +EALNILEKY DD E  IS+AIE   YKTA+RLCSQ ++ DL+   L+PAVLE+YTNL++L+++NW  F K+++RL +VR+ K K P E YDP++  +D DLYSDAGST+A SSRGS+RSF+SSKNRRKHERK+ASLKEGSQYEDVAL+MALH++VTS++ELR  VK++N+ALSC DKDKEA ILQ +LEK LK MKDSF++IWTN+L++EAT A IAAQ  PE     L+GIATLEPHIRIAPVIQD  W+LEGL
Sbjct:  563 VSFPVACPKFSVLSILDTLYFLGLSHKGHLYLNGDVILSNVSSFFIHTHFLLITTLQHVLLCIELTESGITAIAEYQKTESNH-VYKRKIERGAKLVIAVPNDTRTIFQMPRGNLENIQPRPLSLKIIGKYLNQLKYYQAFDLMRKQRINLNLIHDHNPKKFFMFIDFFLDDIENDSWLSLFLSDLENLDVTKTMYASSYADKTSKLNIDYNSKIHRVCDIIRSHLLKRFDKDRKILTLITTFVKKNTDEDLEAALDVVKQLKLKESGGSKLPVGSDEALKYLLYMVDVNQLFHVALGMYDFDLVLLVANKSQKDPKEYIPMLNELNDMEENYKKFSINKHLKRFSRAVEFLVKCGPEKHDELRTFVKYHSLYIDALALFTPEEDIYKQISDDFGLYLKLKKQFIRAGVMYERARSHEKAIECYKEALEWELAIKLGH-KLPADQFRQLCNDLVNGLKEEKRFDEALNILEKYCDDKEDAISFAIEKSQYKTAMRLCSQFNRDDLKVEKLLPAVLEEYTNLRDLVESNWHTFIKYKERLSIVRKKKRKNPIEHYDPAFDNKDSDLYSDAGSTVA-SSRGSTRSFQSSKNRRKHERKVASLKEGSQYEDVALVMALHSLVTSSYELRSTVKKVNIALSCFDKDKEAFILQTSLEKLLKGMKDSFKEIWTNELILEATNAAIAAQNVPEGAHVILQGIATLEPHIRIAPVIQDFNWQLEGL 1278          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|913306823|ref|XP_013183864.1| (PREDICTED: putative elongator complex protein 1 isoform X2 [Amyelois transitella])

HSP 1 Score: 993.03 bits (2566), Expect = 0.000e+0
Identity = 481/719 (66.90%), Postives = 606/719 (84.28%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPR--STVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSK-LEGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF VACPKFS+L I +TLY+LGLSHK  L +NG+VI++ VSS+F+HTHFLLITTLQH+LLC ELT+ G+ AI +YQ  ES+  +YKRKIERG KLV+AV NDTRT+FQMPRGNLE IQPRPLSLK+IG+YL+  +Y++AFDLMRKQRINLNLI+DH+P KF   ID FL  I+N SWL+LFLSDLEN+DVTKTMYASSY +K    +   ++K+H +CD++RSHL +R D D KI+ L+TT+VKKNT EDLE+AL ++K+LK +E+ GSKL +GSD+A+KYLLYMVDVN+LF++ALGMYDF LVLL+A+KSQKDPKEYIPMLNELN+M+ENYK+FSINK+LKRFS+AV+ LV CGPEK++EL+T VKYHSLY +AL  F    DIYK+IS+DFG +L+LKKQ + AG+++ERA ++EKA+ECYK+ALEWELAI++ + +  +D F++LC DLVN LKEEKR +EALNILEKY DD E  IS+AIE   YKTA+RLCSQ ++ DL+   L+PAVLE+YTNL++L+++NW  F K+++RL +VR+ K K P E YDP++  +D DLYSDAGST+A SSRGS+RSF+SSKNRRKHERK+ASLKEGSQYEDVAL+MALH++VTS++ELR  VK++N+ALSC DKDKEA ILQ +LEK LK MKDSF++IWTN+L++EAT A IAAQ  PE     L+GIATLEPHIRIAPVIQD  W+LEGL
Sbjct:  560 VSFPVACPKFSVLSILDTLYFLGLSHKGHLYLNGDVILSNVSSFFIHTHFLLITTLQHVLLCIELTESGITAIAEYQKTESNH-VYKRKIERGAKLVIAVPNDTRTIFQMPRGNLENIQPRPLSLKIIGKYLNQLKYYQAFDLMRKQRINLNLIHDHNPKKFFMFIDFFLDDIENDSWLSLFLSDLENLDVTKTMYASSYADKTSKLNIDYNSKIHRVCDIIRSHLLKRFDKDRKILTLITTFVKKNTDEDLEAALDVVKQLKLKESGGSKLPVGSDEALKYLLYMVDVNQLFHVALGMYDFDLVLLVANKSQKDPKEYIPMLNELNDMEENYKKFSINKHLKRFSRAVEFLVKCGPEKHDELRTFVKYHSLYIDALALFTPEEDIYKQISDDFGLYLKLKKQFIRAGVMYERARSHEKAIECYKEALEWELAIKLGH-KLPADQFRQLCNDLVNGLKEEKRFDEALNILEKYCDDKEDAISFAIEKSQYKTAMRLCSQFNRDDLKVEKLLPAVLEEYTNLRDLVESNWHTFIKYKERLSIVRKKKRKNPIEHYDPAFDNKDSDLYSDAGSTVA-SSRGSTRSFQSSKNRRKHERKVASLKEGSQYEDVALVMALHSLVTSSYELRSTVKKVNIALSCFDKDKEAFILQTSLEKLLKGMKDSFKEIWTNELILEATNAAIAAQNVPEGAHVILQGIATLEPHIRIAPVIQDFNWQLEGL 1275          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|1073524743|gb|JAT79483.1| (hypothetical protein g.8194 [Pectinophora gossypiella])

HSP 1 Score: 981.474 bits (2536), Expect = 0.000e+0
Identity = 483/720 (67.08%), Postives = 605/720 (84.03%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSH--TKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKL--EGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF   CP+F+++ ++  L+ +GLSHK  L I+  +IMN VSS++VHT FL++TTLQH+LLCTELT  GL+AI +Y  NE++  +YKRKIERG KL+V V NDTRTVFQMPRGNLEAIQPRPLSLK+IG+YL + +Y+EAFDLMRKQRINLNLIYDHDP KF+ SI +FL +I+N SWL+LFLSDLENVDVTKTMY+S+Y ++      +   KV  +C++VRS+L  R+D DH+I+P LT++VK NTVEDLESALS+IK LK RE  G+KL +GSD+A+KYLLYMVDVN+LF++ALGMYDF LVLL+A+KSQKDPKE+IPMLNELNEM++NYK+FSINK+LKRF KAV+CLV CGPE+Y ELK  VKYHSLYREAL+ F    ++YK+IS DFG +L+LKKQ  +AGIV+ER GN +KA+ECYKDALEWELA+ +A   W  D FK+LCWDL+N+LK+EKRH EAL+ILE++YDD ++ I YAIESG YKTA+R+C+Q+ K +L+E  L P +LE+Y NL+EL++ NW  F +HRDRL++VRENK K P E+YD ++A RDCDLYSDAGSTLASSSRGSSRS+RSSKNRRKHERK+ASLKEGSQYEDVAL+MALHT+VTS+FELR QV+ +NVALS   +DK+A +LQ +LEK LKEMKDSFRDIWT++LV+EAT A+IAAQ  PE G  +  +G+A+LEPHIRIAPV+QD+ WKLEGL
Sbjct:  552 VSFEAPCPRFNVVSVEGELHLIGLSHKGNLYIDNMMIMNNVSSFYVHTDFLVLTTLQHVLLCTELTNAGLNAIKEYSKNETAH-VYKRKIERGGKLIVVVPNDTRTVFQMPRGNLEAIQPRPLSLKIIGKYLSSLKYYEAFDLMRKQRINLNLIYDHDPKKFINSIKVFLEAIKNNSWLSLFLSDLENVDVTKTMYSSNYADEQNKANDNCENKVQRVCELVRSNLSMRSDTDHRILPFLTSFVKTNTVEDLESALSLIKDLKMREEGGAKLPVGSDEALKYLLYMVDVNKLFDVALGMYDFDLVLLVANKSQKDPKEFIPMLNELNEMEQNYKRFSINKHLKRFDKAVQCLVECGPERYAELKAFVKYHSLYREALNLFTPDQEVYKQISEDFGLYLRLKKQFTDAGIVYERGGNVDKAIECYKDALEWELAVNLA-QMWPKDQFKQLCWDLINSLKDEKRHREALSILEQFYDDKDEAIRYAIESGQYKTAIRICTQYKKDELKEDKLKPGLLEEYKNLQELVENNWCMFIRHRDRLKLVRENKIKNPVEMYD-TFANRDCDLYSDAGSTLASSSRGSSRSYRSSKNRRKHERKVASLKEGSQYEDVALVMALHTLVTSSFELRAQVRDVNVALSYFGQDKQAFVLQTSLEKLLKEMKDSFRDIWTSELVLEATNASIAAQNVPEGGPAVIPQGLASLEPHIRIAPVVQDISWKLEGL 1268          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|943937169|ref|XP_014368772.1| (PREDICTED: elongator complex protein 1 [Papilio machaon] >gi|930679562|gb|KPJ19391.1| Elongator complex protein 1 [Papilio machaon])

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 450/718 (62.67%), Postives = 555/718 (77.30%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKL--EGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF  +C KF ++F+   L++LGLS K  L I+   ++N VSSYFVHT FLLITTLQH LLCTEL++ GL+AI +YQ N+S + +YKRKIERG KLV++V N T T+FQMPRGNLE IQPRPLSLK+IGE LD+  Y +AFDLMRKQRINLNLIYDH+P  F+++ID FL SI+N SWL LFLSDLEN DVTKTMY SSY N   +     K+  ICD+V++ + +R+D   KI+PLLTTY+KKNT+EDLE AL IIK++K  E    KLA+GSD+AIK+LLYMV+V+ELFN+ALGMYDF LVLL+A+KSQKDPKEYIPMLNELN MD+NYK+FSINKYLKRF KAVK LV CG +KYEELK  VKYHSLY+EAL+ F    DIYKEI++DFG +L+LKK  VEAG+++ER+ NY KAV+CYK+ALEWELA+ + +   T D   E C  LV+ALK+EKRH EAL ILE+Y  +    I YAIE+G YKTA+RL S++++ DLRE  L+PA+LE+Y N K LI+ N  +F KHR RL  VRENK      +YD     +D DLYSDAGST+ASS  G S    SSKNRRKH+RK+ASLKEGSQYEDVALIM LH++VTS+F LRLQVK +NV LS  +KDK A  LQ  L+  L EM+  F++IWTNDLV++ATKA I A+  PE GS +  + ++ LEPH+RIAPVIQD+ WKLEGL
Sbjct:  558 ISFKTSCSKFDIVFVQNKLHFLGLSQKGNLYIDNVSVLNNVSSYFVHTSFLLITTLQHYLLCTELSQTGLEAITEYQKNDSPQ-VYKRKIERGAKLVISVPNATNTIFQMPRGNLETIQPRPLSLKIIGEQLDSLDYEKAFDLMRKQRINLNLIYDHNPKLFLDNIDKFLDSIKNTSWLCLFLSDLENSDVTKTMYKSSYKNNVNN--ESMKIQEICDIVQTQINKRSDRSDKILPLLTTYIKKNTIEDLEKALLIIKEIKVHEMGNHKLAVGSDEAIKFLLYMVNVDELFNVALGMYDFDLVLLVANKSQKDPKEYIPMLNELNGMDDNYKKFSINKYLKRFDKAVKYLVKCGSDKYEELKAFVKYHSLYKEALELFNENEDIYKEIADDFGLYLKLKKDFVEAGVIYERSKNYIKAVDCYKEALEWELALSIVH-YLTDDQRVETCRYLVDALKDEKRHKEALTILEQYLQNGVDAIIYAIENGQYKTAIRLLSKYNRPDLREQRLLPALLEEYQNFKGLIENNLKDFIKHRTRLSEVRENKLNKADCMYDAFNTNKDDDLYSDAGSTIASSGSGRSFR--SSKNRRKHQRKVASLKEGSQYEDVALIMTLHSLVTSSFNLRLQVKDVNVTLSVFNKDKMASQLQRNLDNLLNEMRSHFKEIWTNDLVLQATKAAIDAENIPE-GSNIIADSLSFLEPHVRIAPVIQDISWKLEGL 1268          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|304307733|ref|NP_001182006.1| (elongator complex protein 1 [Bombyx mori] >gi|302190084|dbj|BAJ14102.1| elongator complex protein 1 [Bombyx mori])

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 461/718 (64.21%), Postives = 569/718 (79.25%), Query Frame = 0
Query:    3 FSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYAS--SYPNKPRSTVSHT-KVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKL-EGIATLEPHIRIAPVIQDVKWKLEGL 716
            F V CP+F +L I+++L+++GLSHK  L I+   +++ VSS+F+HT FLL+TTLQHLLLC E  KLGL A+++YQTNES + +YKRKIERG KLV+ V NDTRT+ QMPRGN+EAIQPRPLSLK+IG+YLD  +Y+EAFDLMRKQRINLNLI+DH+P KF+ +ID FL SI+N SWL LFLSDLEN+ VTKTM++S   Y  +P  T   + K+  +C+M R+H+++R+D   KI+PLLTTYVKKNTV+DL+ AL IIK LK +E SG K+ + SD+A+KYLLYMVDV +LF+IALGMYDF LVLL+A KSQKDPKEYIPMLNELNEMDENYK+F+INK LKRF KAV+ LV+CGP ++ ELKT VKYHSLY+EAL  F    +I++EIS D+G HL+LKK + EA I++ERA N +KA+ECYK+ALEWELAI++AY  W    FK LCW+LV ALKEEKRH EAL ILE++Y D E+ ISYA+E+ HYK ALRLCS + K  L+E  ++PA+LE+Y N+ +LI+ N S F KHR+RL  VR  K   P ++YD  Y  +D DLYSDAGSTLASSSRGSSRS+RSSKNRRKHERK+ASLKEGSQYEDV LI+ALH ++TSTF+LR  VK L V L C + DKEA ILQ  LEK L EMKDSF+DIWTND ++EAT ATI A    E  S L  GIA+LE H RI PVIQ++ WKLEGL
Sbjct:  557 FKVPCPRFGILPIEDSLHFIGLSHKGHLFIDNVQVLSNVSSFFIHTDFLLLTTLQHLLLCVEKNKLGLKALMEYQTNES-DYVYKRKIERGAKLVIIVPNDTRTILQMPRGNIEAIQPRPLSLKIIGKYLDNLKYYEAFDLMRKQRINLNLIFDHNPKKFIANIDTFLHSIKNNSWLNLFLSDLENIXVTKTMFSSINYYAERPAVTDEISRKIDIVCEMFRAHIEKRSDKATKILPLLTTYVKKNTVDDLQKALEIIKGLKKQETSGEKIPVSSDEALKYLLYMVDVTQLFDIALGMYDFELVLLVATKSQKDPKEYIPMLNELNEMDENYKRFTINKQLKRFDKAVQSLVLCGPTRHCELKTFVKYHSLYQEALKHFSFEEEIFREISEDYGQHLKLKKYYTEAAIIYERANNNDKAIECYKEALEWELAIKLAY-FWPKAQFKVLCWELVTALKEEKRHEEALIILEQFYGDPEECISYAVETSHYKKALRLCSLYDKLQLKEERILPALLEEYQNMTDLIETNRSTFLKHRERLFHVRNIKRDNPVDLYD-IYTNKDADLYSDAGSTLASSSRGSSRSYRSSKNRRKHERKIASLKEGSQYEDVGLIIALHCLITSTFDLRNHVKDLTVGLICFNMDKEAFILQKALEKLLNEMKDSFKDIWTNDFMLEATNATITAHNISEGSSVLPPGIASLELHFRIPPVIQEINWKLEGL 1271          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|930656102|gb|KPI98429.1| (Elongator complex protein 1 [Papilio xuthus])

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 441/717 (61.51%), Postives = 557/717 (77.68%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKL-EGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF  +C KF ++ I+  L++LGLS K  L I+   ++N VSSYFVHT FLLITTLQH LLCTEL++ GL+AI +YQ N+S + +YKRKIERG KLV++V N T T+FQMPRGNLE IQPRPLSLK+IGE LD+  Y +AFDLMRKQRINLNLI+DH+P  F+++ID FL SI+N SWL LFLSDLEN DVTKTMY SSY N   +  ++ K+  ICD++++ + +R+D + KI+PLLTTY+KKNT+EDLE AL IIK++K  E    KLA+GSD+AI++LLYMV+V+ELFN+ALGMYDF LVLL+A+KSQKDPKEYIPMLNELN MD+NYK+FSINKYLKRF KAVK L+ CG +K+EELK  VKYHSLY++AL       DIYKEI++DFG +L+LKK  VEAGIV+ER+ NY KA++CYK+A EWELA+ VA    T D   E C  LVNALK+EKRH EAL ILE++  +   +I YAIE+G YKTA++LCS++++ DLR+  L+PA+LE+Y NLK LI+ N  +F KHR RL  VRENK      +YD     +D DLYSDAGST+ASS  G S    SSKNRRKH+RK+ASLKEGSQYEDVALIM LH++VT++F LRLQVK +N+ L+  +KDK A  LQ  L+  L EMK  F++IWTNDLV++ATKA I A+  PE  S + + ++ LEPH+RI+PVIQD+ WKLEGL
Sbjct:  555 ISFKTSCSKFDVVLIENKLHFLGLSQKGNLYIDDVSVLNNVSSYFVHTSFLLITTLQHYLLCTELSETGLEAITEYQKNDSPQ-VYKRKIERGAKLVISVPNATNTIFQMPRGNLETIQPRPLSLKIIGEQLDSLDYGKAFDLMRKQRINLNLIHDHNPKLFLDNIDKFLDSIKNTSWLCLFLSDLENSDVTKTMYKSSYKNNVNNE-NYMKIQEICDIIQTQINKRSDRNDKILPLLTTYIKKNTIEDLEKALLIIKEIKVHEMGNHKLAVGSDEAIRFLLYMVNVDELFNVALGMYDFDLVLLVANKSQKDPKEYIPMLNELNGMDDNYKKFSINKYLKRFDKAVKYLIKCGSDKHEELKAFVKYHSLYKDALSLLNENEDIYKEIADDFGLYLKLKKDFVEAGIVYERSKNYVKAIDCYKEASEWELALSVA-QYLTEDQRLETCRYLVNALKDEKRHKEALIILEQHLQNGVDSIIYAIENGQYKTAIQLCSKYNRPDLRDQRLMPAILEEYQNLKGLIENNLKDFIKHRTRLSEVRENKLNKADCMYDAFNTNKDDDLYSDAGSTIASSGSGRSFR--SSKNRRKHQRKVASLKEGSQYEDVALIMTLHSLVTASFNLRLQVKDVNITLNVFNKDKMASELQRNLDNLLNEMKGHFKEIWTNDLVLQATKAAIDAENIPEGSSMIADSLSFLEPHVRISPVIQDISWKLEGL 1266          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|768426108|ref|XP_011554085.1| (PREDICTED: putative elongator complex protein 1 [Plutella xylostella])

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 441/713 (61.85%), Postives = 569/713 (79.80%), Query Frame = 0
Query:    7 CPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLL-CTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLA-SSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGS-KLEGIATLEPHIRIAPVIQDVKWKLEGL 716
            CPKFS+L +D+ L ++GLS K  L IN   +++ +SSYFVH+HFLL+TT    LL C EL+K GLDA+  YQ N+S  K+YKRKIE G KLV+AVA DTRTVFQ+PRGNLEAIQPRPLSLK+IG+YL+  +Y+EAFDLMRKQRINLNLIYDHDP KF+ +ID+FL SI+N SWL+LFLSDLEN+DVTKTMYA+SY N   +  S TK+  ICD++R+HL+   D ++KI+PL+TTYVKKNTV DLE+ALS++KKLK +E++GSKL +GSD+A+KYLLYMVDV+ LF+IALGMYDF LVLL+A+KSQKDPKEYIPMLNELNEM+ENYK+F+INK LKRF +AV CL  CGP+K+EEL++ VKY+SLYR+ L+ F    +IYK++S+D+G  L+L+KQ+ EAGI++ R+ NYEKA+EC+K+ LEWELAIE+  + W  +   +LC +L   LK+  R  EAL +LE+Y DD E TI +A+  G YKTALRLCSQ  K +L+   ++PA++ ++ N ++ I++  + F K RDRLQVVRE K + P E YD SYA +D DLYSDAGSTLA ++SR SSR+FRSSKNRRKHERK+AS KEGSQYEDV L++ALH +V S F+LRL V++L +ALSC + DKE  +LQ +L+  LK+MKDSF+DIWT+DLV+EAT A I A+  PE  S   +GIA+L+ H+RIAPVI DVKW+L+G 
Sbjct:  567 CPKFSVLDVDDDLQFIGLSLKGNLYINDTKVLSNISSYFVHSHFLLLTTTLKHLLLCVELSKDGLDALKDYQKNDSP-KVYKRKIETGAKLVIAVAQDTRTVFQLPRGNLEAIQPRPLSLKIIGDYLNDLKYYEAFDLMRKQRINLNLIYDHDPEKFLNNIDVFLKSIKNNSWLSLFLSDLENLDVTKTMYATSYNNGKTTNGSDTKIQRICDIIRTHLENIQDKENKILPLITTYVKKNTVVDLENALSVVKKLKEQESAGSKLPVGSDEALKYLLYMVDVSNLFDIALGMYDFDLVLLVANKSQKDPKEYIPMLNELNEMEENYKRFTINKRLKRFDRAVDCLAACGPDKHEELRSFVKYYSLYRKCLELFKPEDEIYKQVSDDYGLFLKLEKQYTEAGIIYRRSKNYEKAIECFKEDLEWELAIELTED-WPKEQRLQLCRELFEGLKDNNRSQEALTMLERYTDDPEDTIKHAVTFGCYKTALRLCSQFGKDNLKNELILPAIMAEFNNTQQQIESYKTTFIKQRDRLQVVRETKKQTPFEDYDASYANKDSDLYSDAGSTLASTTSRSSSRTFRSSKNRRKHERKVASCKEGSQYEDVGLVIALHNLVKSAFDLRLHVRELCLALSCFECDKETFVLQRSLQNLLKDMKDSFKDIWTSDLVLEATNAAIPARNVPEGFSVAPQGIASLDAHLRIAPVIPDVKWELKGF 1277          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|910333107|ref|XP_013169931.1| (PREDICTED: putative elongator complex protein 1 [Papilio xuthus])

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 440/717 (61.37%), Postives = 557/717 (77.68%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKL-EGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF  +C KF ++ I+  L++LGLS K  L I+   ++N VSSYFVHT FLLITTLQH LLCTEL++ GL+AI +YQ N S + +YKRKIERG KLV++V N T T+FQMPRGNLE IQPRPLSLK+IGE LD+  Y +AFDLMRKQRINLNLI+DH+P  F+++ID FL SI+N SWL LFLSDLEN DVTKTMY SSY +   +  ++ K+  ICD++++ + +R+D + KI+PLLTTY+KKNT+EDLE AL IIK++K +E    KLA+GSD+AI++LLYMV+V+ELFN+ALGMYDF LVLL+A+KSQKDPKEYIPMLNELN MD+NYK+FSINKYLKRF KAVK L+ CG +K+EELK  VKYHSLY++AL       DIYKEI++DFG +L+LKK  VEAG+V+ER+ NY KA++CYK+A EWELA+ VA    T D   E C  LVNALK+EKRH EAL ILE++  +   +I YAIE+G YKTA++LCS++++ DLR+  L+PA+LE+Y NLK LI+ N  +F KHR RL  VRENK      +YD     +D DLYSDAGST+ASS  G S    SSKNRRKH+RK+ASLKEGSQYEDVALIM LH++VT++F LRLQVK +N+ L+  +KDK A  LQ  L+  L EMK  F++IWTNDLV++ATKA I A+  PE  S + + ++ LEPH+RIAPVIQD+ WKLEGL
Sbjct:  555 ISFKTSCSKFDVVLIENKLHFLGLSQKGNLYIDDVSVLNNVSSYFVHTSFLLITTLQHYLLCTELSETGLEAITEYQKNNSPQ-VYKRKIERGAKLVISVPNATNTIFQMPRGNLETIQPRPLSLKIIGEQLDSLDYGKAFDLMRKQRINLNLIHDHNPKLFLDNIDKFLDSIKNTSWLCLFLSDLENSDVTKTMYKSSYKSNVNNE-NYMKIQEICDIIQTQINKRSDRNDKILPLLTTYIKKNTIEDLEKALLIIKEIKVQEMGNHKLAVGSDEAIRFLLYMVNVDELFNVALGMYDFDLVLLVANKSQKDPKEYIPMLNELNGMDDNYKKFSINKYLKRFDKAVKYLIKCGSDKHEELKAFVKYHSLYKDALSLLNENEDIYKEIADDFGLYLKLKKDFVEAGVVYERSKNYVKAIDCYKEASEWELALSVA-QYLTEDQRLETCRYLVNALKDEKRHKEALIILEQHLQNGVDSIIYAIENGQYKTAIQLCSKYNRPDLRDQRLMPAILEEYQNLKALIENNLKDFIKHRTRLSEVRENKLNKADCMYDAFNTNKDDDLYSDAGSTIASSGSGRSFR--SSKNRRKHQRKVASLKEGSQYEDVALIMTLHSLVTASFNLRLQVKDVNITLNVFNKDKMASELQRNLDNLLNEMKGHFKEIWTNDLVLQATKAAIDAENIPEGSSMIADSLSFLEPHVRIAPVIQDISWKLEGL 1266          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|909569983|ref|XP_013140520.1| (PREDICTED: putative elongator complex protein 1 [Papilio polytes])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 439/718 (61.14%), Postives = 556/718 (77.44%), Query Frame = 0
Query:    1 MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKL--EGIATLEPHIRIAPVIQDVKWKLEGL 716
            +SF  +C +F ++ I   L++LGLS K    I+   ++N +SSYFVHT FLLITTLQH LLCTEL++ G++AI +YQ N+SS+ +YKRKIERG KLV++V N T T+FQMPRGNLE IQPRPLSLK+IGE LD   Y +AF+LMRKQRINLNLI+DH+P  F+ +ID FL SI+N SWL LFLSDLEN DVTKTMY SSY N   +  S  K+  IC+++++ + +R D   KI+PLLTTY+KKNT+EDLE AL +IK++K +E S  KL +GSD+AI++LLYMV+V+ELFN+ALGMYDF LVLL+A+KSQKDPKEYIPMLNELN MDENYK+FSINKYLKRF KAVK LV CG +KYEELK  VKYHSLY+EAL  F    DIYKEI++DFG +L+LKK  VEAG+V+ER+ +Y KAV+CYK+ALEWELA+ VA    T +  +E+   LVNALK+EKRH EAL ILE++  + E  I YAIE+G YKTA+RLCS++++ DL++  L+PA+LE+Y NLK LI+ N  +F KHR RL  VR+NK      +YD     +D DLYSD GST+ASS  G S    SSKNRRKH+RK+ASLKEGSQYEDVA+IM LH +VTS+F LRLQV+ +N+ L+  +KDK A+ LQ  L+  L EMK+ F++IWTNDLV++ATKA I A+  PE GS +  + ++ LEPH+RIAPVIQD+ WKLEGL
Sbjct:  555 ISFKTSCSQFDIILIQNKLHFLGLSQKGIFYIDNVSVLNNISSYFVHTSFLLITTLQHYLLCTELSETGIEAITEYQKNDSSQ-VYKRKIERGAKLVISVPNATNTIFQMPRGNLETIQPRPLSLKIIGEQLDTLDYEKAFNLMRKQRINLNLIHDHNPTLFLNNIDKFLDSIKNTSWLCLFLSDLENSDVTKTMYKSSYKNNINNE-SDMKIKKICNIIQAQINKRNDRSDKILPLLTTYIKKNTIEDLEQALLVIKEIKLQELSNHKLTVGSDEAIRFLLYMVNVDELFNVALGMYDFDLVLLVANKSQKDPKEYIPMLNELNAMDENYKKFSINKYLKRFVKAVKYLVECGTDKYEELKAFVKYHSLYKEALALFNENEDIYKEIADDFGLYLKLKKDFVEAGVVYERSKSYIKAVDCYKEALEWELALSVA-QYLTDEQREEISRYLVNALKDEKRHKEALTILEQHLQNGESAIIYAIENGQYKTAIRLCSKYNRLDLKDYRLLPAILEEYQNLKGLIENNLKDFIKHRTRLAEVRDNKLNKADCLYDAFNTNKDDDLYSDVGSTIASSGSGRSFR--SSKNRRKHQRKVASLKEGSQYEDVAIIMTLHNLVTSSFNLRLQVRDVNITLNVFNKDKMAVELQRNLDNLLNEMKNHFKEIWTNDLVLQATKAAIDAENIPE-GSNIIADSLSFLEPHVRIAPVIQDINWKLEGL 1266          
BLAST of HiSeq35283 vs. genbank:protein
Match: gi|914576066|gb|KOB78004.1| (Elongator complex protein 1 [Operophtera brumata])

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 384/714 (53.78%), Postives = 494/714 (69.19%), Query Frame = 0
Query:    3 FSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHFLLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAVANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRINLNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSYPNKPRSTVSH--TKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDLESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDFGLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCLVMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKKQHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWDLVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSKSDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSEIYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKEGSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTLEKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPE-TGSKLEGIATLEPHIRIAPVIQDVKWKL 713
            F  ACP+F+++ I++ +++LGL+H   L+I+    ++ VSS FVHTHFLLITTL H L+C ELTK G++A+ ++ +  + +  YKRKIERG+KLV+ V  D RTV QMPRGNLE+IQPRPLSLK+IGEYLD+ +++EAF+LMRKQRINLNLIYDH+P KF+ +ID FL SI+N SWL LFLSDLEN DVT TMY +SY  KP     +  +K+  +CD+VR  + +R D D KI+P++TT+VKKNT E+LE AL  IK+LK +E+ GSKL +GSD+A+KYLLYMVDVN+LF++ALGMYDF L LLIA KSQKDPKEYIPMLNE N++DENYK+F+INK+LKRF  AV+CLV CGP ++ EL+T VKYHSLYR+AL       +++KEIS+D+G +L+LKKQH++AG V+ER+ N +KAV+                              LV+ L+EEKRH EAL ++E+YY++ E+TI YAIE G YKTAL+L                                        +RL VVRE K K P EIYD  Y  +D DLYSD GST+ASSSRGS+         RKHERK+ASLKEGSQYEDVALIMALH +VT + E+RLQV++ +                 +L K LKEM+DSF+DIWTN+L +EAT A IAA   PE T   L+GIA++  H+RIAPVI    WKL
Sbjct:  541 FPKACPQFNVIGIEDNIHFLGLTHTGHLHIDNAREIHSVSSIFVHTHFLLITTLSHELVCVELTKPGINAMKEFHS--APDLAYKRKIERGSKLVIVVPCDNRTVLQMPRGNLESIQPRPLSLKIIGEYLDSSKFYEAFNLMRKQRINLNLIYDHNPEKFINNIDKFLDSIKNNSWLNLFLSDLENADVTNTMYHNSYVGKPEKLKQNVDSKIVNVCDLVRDQINKRNDKDTKILPIITTFVKKNTGEELEKALLTIKELKLKESGGSKLPVGSDEALKYLLYMVDVNQLFDVALGMYDFDLALLIATKSQKDPKEYIPMLNEFNDLDENYKRFTINKHLKRFDNAVECLVKCGPSRHGELRTFVKYHSLYRDALALLSSQDEVFKEISDDYGLYLKLKKQHIQAGFVYERSNNIDKAVQ-----------------------------QLVSLLQEEKRHQEALIMMERYYENYEETIEYAIECGQYKTALQL----------------------------------------ERLFVVREIKAKNPPEIYD--YNQKDSDLYSDIGSTIASSSRGST---------RKHERKMASLKEGSQYEDVALIMALHKLVTVSHEMRLQVRETS-----------------SLAKLLKEMRDSFKDIWTNELELEATNALIAASDAPEGTNVVLQGIASIAHHLRIAPVIN---WKL 1152          
The following BLAST results are available for this feature:
BLAST of HiSeq35283 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913306821|ref|XP_013183863.1|0.000e+066.90PREDICTED: putative elongator complex protein 1 is... [more]
gi|913306823|ref|XP_013183864.1|0.000e+066.90PREDICTED: putative elongator complex protein 1 is... [more]
gi|1073524743|gb|JAT79483.1|0.000e+067.08hypothetical protein g.8194 [Pectinophora gossypie... [more]
gi|943937169|ref|XP_014368772.1|0.000e+062.67PREDICTED: elongator complex protein 1 [Papilio ma... [more]
gi|304307733|ref|NP_001182006.1|0.000e+064.21elongator complex protein 1 [Bombyx mori] >gi|3021... [more]
gi|930656102|gb|KPI98429.1|0.000e+061.51Elongator complex protein 1 [Papilio xuthus][more]
gi|768426108|ref|XP_011554085.1|0.000e+061.85PREDICTED: putative elongator complex protein 1 [P... [more]
gi|910333107|ref|XP_013169931.1|0.000e+061.37PREDICTED: putative elongator complex protein 1 [P... [more]
gi|909569983|ref|XP_013140520.1|0.000e+061.14PREDICTED: putative elongator complex protein 1 [P... [more]
gi|914576066|gb|KOB78004.1|0.000e+053.78Elongator complex protein 1 [Operophtera brumata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0002098 tRNA wobble uridine modification
cellular_component GO:0005737 cytoplasm
cellular_component GO:0033588 Elongator holoenzyme complex
cellular_component GO:0005634 nucleus
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 370..472
e-value: 4.0E-6
score: 25.1
IPR006849IKI3PFAMPF04762IKI3coord: 2..354
e-value: 9.9E-114
score: 380.9
IPR006849IKI3PANTHERPTHR12747IKAPPAB KINASE COMPLEX-ASSOCIATED PROTEINcoord: 1..669
NoneNo IPR availableSUPERFAMILY48452TPR-likecoord: 338..497

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35283HiSeq35283Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35283_p ID=HiSeq35283_p|Name=HiSeq35283|organism=Ostrinia scapulalis|type=polypeptide|length=717bp
MSFSVACPKFSLLFIDETLYYLGLSHKNTLNINGNVIMNGVSSYFVHTHF
LLITTLQHLLLCTELTKLGLDAIIQYQTNESSEKIYKRKIERGTKLVVAV
ANDTRTVFQMPRGNLEAIQPRPLSLKVIGEYLDAKQYHEAFDLMRKQRIN
LNLIYDHDPIKFVESIDIFLGSIQNVSWLTLFLSDLENVDVTKTMYASSY
PNKPRSTVSHTKVHTICDMVRSHLKQRADIDHKIVPLLTTYVKKNTVEDL
ESALSIIKKLKTRENSGSKLAIGSDDAIKYLLYMVDVNELFNIALGMYDF
GLVLLIADKSQKDPKEYIPMLNELNEMDENYKQFSINKYLKRFSKAVKCL
VMCGPEKYEELKTLVKYHSLYREALDQFPVGSDIYKEISNDFGHHLQLKK
QHVEAGIVFERAGNYEKAVECYKDALEWELAIEVAYNRWTSDHFKELCWD
LVNALKEEKRHNEALNILEKYYDDCEKTISYAIESGHYKTALRLCSQHSK
SDLRETTLVPAVLEDYTNLKELIDANWSNFTKHRDRLQVVRENKNKGPSE
IYDPSYAIRDCDLYSDAGSTLASSSRGSSRSFRSSKNRRKHERKLASLKE
GSQYEDVALIMALHTVVTSTFELRLQVKQLNVALSCLDKDKEALILQMTL
EKCLKEMKDSFRDIWTNDLVMEATKATIAAQTGPETGSKLEGIATLEPHI
RIAPVIQDVKWKLEGLN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0033588Elongator holoenzyme complex
Vocabulary: Biological Process
TermDefinition
GO:0002098tRNA wobble uridine modification
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR006849IKI3
IPR011990TPR-like_helical_dom