HiSeq35287_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35287
Unique NameHiSeq35287_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length540
Homology
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|913303890|ref|XP_013200956.1| (PREDICTED: inositol-3-phosphate synthase [Amyelois transitella])

HSP 1 Score: 989.178 bits (2556), Expect = 0.000e+0
Identity = 467/539 (86.64%), Postives = 502/539 (93.14%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENGD 539
            ME NTSLVV SPN KYTD+YI+SDY YEETLVTKTGNE VAKPYRK++CLRT +KVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSW TKNG MDSNWFGSITQASTVRLGIDEKG DV++PM QLLPM+HPDDL IDGWDISPLNLAESMVRAKVID+DLQQKL+KEMAAMKPRPAIYDPDFIAANQADRATNLIRGTK EQYLQLRADIKDFRD++KLDKVIVLWTANTERFC+ R GVHDTSENLE+ALR+NDSEISPSTIFA+AAIDEGC YINGSPQNTLVPGV+ERAEK GV VAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEI+KSNVVDDMVESN +LYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLV+LAD   RV  R ++SQEW+ +H+V+S LSYLLKAP+VP G PVVNALFKQRA ++NL+RACLGL P +H QLEHKVPFLM+EL SG MFS +PPPKKQK++  NGD
Sbjct:    1 MENNTSLVVKSPNTKYTDEYIFSDYEYEETLVTKTGNEIVAKPYRKAICLRTGRKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWTTKNGQMDSNWFGSITQASTVRLGIDEKGQDVFVPMSQLLPMVHPDDLFIDGWDISPLNLAESMVRAKVIDYDLQQKLRKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKQEQYLQLRADIKDFRDKKKLDKVIVLWTANTERFCEFRAGVHDTSENLERALRSNDSEISPSTIFALAAIDEGCTYINGSPQNTLVPGVVERAEKAGVFVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEITKSNVVDDMVESNGMLYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVVLADLFSRVHFRPDESQEWSRMHSVLSPLSYLLKAPLVPAGTPVVNALFKQRACIDNLLRACLGLPPQNHTQLEHKVPFLMSELQSGRMFSGAPPPKKQKISQANGD 539          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|910352512|ref|XP_013180218.1| (PREDICTED: inositol-3-phosphate synthase [Papilio xuthus])

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 442/538 (82.16%), Postives = 493/538 (91.64%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENG 538
            MEK++++ V SPNVKYT+DYIY+DY YEETLVTK  NE + KPY+ SLC+RTA+KVG++G+MLVGWGGNNGSTFTAAVLANRHQLSW TKNG MD NW+GSITQASTVRLGIDE G DVY+ M +LLPM+HPDDLVIDGWDISPLNLAESMVRAKVID+DLQQKLKKEM+AMKPRPAIYDPDFIAANQADRATNLIRGT++EQYLQ+RADIKD RDR KLD VIVLWTANTERFC+VR GVHDTS+NLE+ALRNND+EISPSTIFAMAAIDEGC YINGSPQNT+V GV+ERAE+ GV VAGDDFKSGQTKLKSVLVDFLV+AGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEI+KSNVVDDMVESN ILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNT+ VHNTCEDSLLA PLILDL LL +   RV +R++D+++W  LH V+S +SYLLKAP+VP+GAPVVNAL KQRAA+EN+MRACL L+P HH+QLEHKVPFL AEL SGAMF+ +PP K+QK A +NG
Sbjct:    1 MEKSSNIQVISPNVKYTEDYIYADYEYEETLVTKKDNELLVKPYQTSLCIRTARKVGRLGIMLVGWGGNNGSTFTAAVLANRHQLSWQTKNGKMDPNWYGSITQASTVRLGIDESGKDVYVGMSELLPMVHPDDLVIDGWDISPLNLAESMVRAKVIDYDLQQKLKKEMSAMKPRPAIYDPDFIAANQADRATNLIRGTRYEQYLQVRADIKDCRDRNKLDSVIVLWTANTERFCEVRAGVHDTSDNLERALRNNDTEISPSTIFAMAAIDEGCCYINGSPQNTMVSGVVERAERAGVFVAGDDFKSGQTKLKSVLVDFLVTAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEITKSNVVDDMVESNAILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTLAVHNTCEDSLLATPLILDLALLTELFSRVQLRRDDTEDWQGLHAVLSLVSYLLKAPLVPEGAPVVNALGKQRAAIENMMRACLALRPIHHMQLEHKVPFLRAELQSGAMFAGAPPNKRQKRA-QNG 537          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|930660333|gb|KPJ02325.1| (Inositol-3-phosphate synthase [Papilio xuthus])

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 441/538 (81.97%), Postives = 492/538 (91.45%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENG 538
            MEK++++ V SPNVKYT+DYIY+DY YEETLVTK  NE + KPY+ SLC+RTA+KVG++G+MLVGWGGNNGSTFTAAVLANRHQLSW TKNG MD NW+GSITQASTVRLGIDE G DVY+ M +LLPM+HPDDLVIDGWDISPLNLAESMVRAKVID+DLQQKLKKEM+AMKPRPAIYDPDFIAANQADRATNLIRGT++EQYLQ+RADIKD RDR KLD VIVLWTANTERFC+VR GVHDTS+NLE+ALRNND+EISPSTIFAMAAIDEGC YINGSPQNT+V GV+ERAE+ GV VAGDDFKSGQTKLKSVLVDFLV+AGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEI+KSNVVDDMVESN ILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNT+ VHNTCEDSLLA PLILDL LL +   RV +R++D+++W  LH V+S +SYLLKAP+V +GAPVVNAL KQRAA+EN+MRACL L+P HH+QLEHKVPFL AEL SGAMF+ +PP K+QK A +NG
Sbjct:    1 MEKSSNIQVISPNVKYTEDYIYADYEYEETLVTKKDNELLVKPYQTSLCIRTARKVGRLGIMLVGWGGNNGSTFTAAVLANRHQLSWQTKNGKMDPNWYGSITQASTVRLGIDESGKDVYVGMSELLPMVHPDDLVIDGWDISPLNLAESMVRAKVIDYDLQQKLKKEMSAMKPRPAIYDPDFIAANQADRATNLIRGTRYEQYLQVRADIKDCRDRNKLDSVIVLWTANTERFCEVRAGVHDTSDNLERALRNNDTEISPSTIFAMAAIDEGCCYINGSPQNTMVSGVVERAERAGVFVAGDDFKSGQTKLKSVLVDFLVTAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEITKSNVVDDMVESNAILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTLAVHNTCEDSLLATPLILDLALLTELFSRVQLRRDDTEDWQGLHAVLSLVSYLLKAPLVAEGAPVVNALGKQRAAIENMMRACLALRPIHHMQLEHKVPFLRAELQSGAMFAGAPPNKRQKRA-QNG 537          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|909570820|ref|XP_013140973.1| (PREDICTED: inositol-3-phosphate synthase [Papilio polytes])

HSP 1 Score: 937.176 bits (2421), Expect = 0.000e+0
Identity = 440/538 (81.78%), Postives = 489/538 (90.89%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENG 538
            MEK++++ V SPNVKYTDDYIY+DY YEETLVTK  NE + KPY+ SLC+RT +KVG++G+MLVGWGGNNGSTFTAAVLANRHQLSW TKNG MD NW+GSITQASTVRLGIDE G DVY+ M +LLPM+HPDDLVIDGWDISPLNLAESMVRAKVID+DLQQKLKKEM+AMKPRPAIYDPDFIAANQADRATNLIRGT++EQYLQ+RADIKD RDR KLD +IVLWTANTERFC+VR GVHDTS+NLE+ALRNNDSEISPSTIFAMAAIDEGC YINGSPQNTLV G ++RAE+  V VAGDDFKSGQTKLKSVLVDFLV+AGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEI+KSNVVDDMVESN ILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNT+ VHNTCEDSLLA PLILDL LLA+   RV +R++D++EW  LH V+S +SYLLKAP+V  GAPVVNAL KQRAA+EN++RACL L+PTHH+QLEHKV FL AEL SGAMF+ +PP K+QK A +NG
Sbjct:    1 MEKSSNIQVISPNVKYTDDYIYADYEYEETLVTKKDNELLVKPYQTSLCIRTGRKVGRLGIMLVGWGGNNGSTFTAAVLANRHQLSWQTKNGKMDPNWYGSITQASTVRLGIDESGQDVYVGMSELLPMVHPDDLVIDGWDISPLNLAESMVRAKVIDYDLQQKLKKEMSAMKPRPAIYDPDFIAANQADRATNLIRGTRYEQYLQVRADIKDCRDRNKLDTIIVLWTANTERFCEVRAGVHDTSDNLERALRNNDSEISPSTIFAMAAIDEGCCYINGSPQNTLVSGAVQRAERAAVFVAGDDFKSGQTKLKSVLVDFLVTAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEITKSNVVDDMVESNSILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTLAVHNTCEDSLLAAPLILDLALLAELFSRVQLRRDDTEEWEGLHAVLSLVSYLLKAPLVAAGAPVVNALAKQRAAIENMLRACLALRPTHHMQLEHKVQFLRAELQSGAMFAGAPPNKRQKRA-QNG 537          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|943956965|ref|XP_014361296.1| (PREDICTED: inositol-3-phosphate synthase [Papilio machaon] >gi|930672179|gb|KPJ12797.1| Inositol-3-phosphate synthase [Papilio machaon])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 421/509 (82.71%), Postives = 469/509 (92.14%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKV 509
            MEK++++ V SPNVKYT+DYIY+DY YEETLVTK  NE + KPY+ SLC+RTA+KVG++G+MLVGWGGNNGSTFTAAVLANRHQLSW TKNG MD NW+GSITQASTVRLGIDE G DVY+ M +LLPM+HPDDLVIDGWDISPLNLAESMVRAKVID+DLQQKLKKEM+AMKPRPAIYDPDFIAANQADRATNLIRG+++EQYLQ+RADIKD RDR KLD VIVLWTANTER C+VR GVHDTS+NLE+ALRNND+EISPSTIFAMAA+DEGC YINGSPQNTLV GV+ERAE+ GV VAGDDFKSGQTKLKSVLVDFLV+AGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEI+KSNVVDDMVESN ILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNT+ VHNTCEDSLLA PLILDL LL +   RV +R++D++EW SLH V+S +SYLLKAP+V +GAPVVNAL KQRAA+EN+MRACL L+P H++QLEHKV
Sbjct:    1 MEKSSNIQVISPNVKYTEDYIYADYEYEETLVTKKDNELLVKPYQTSLCIRTARKVGRLGIMLVGWGGNNGSTFTAAVLANRHQLSWQTKNGKMDPNWYGSITQASTVRLGIDESGKDVYVGMSELLPMVHPDDLVIDGWDISPLNLAESMVRAKVIDYDLQQKLKKEMSAMKPRPAIYDPDFIAANQADRATNLIRGSRYEQYLQVRADIKDCRDRNKLDSVIVLWTANTERLCEVRAGVHDTSDNLERALRNNDTEISPSTIFAMAAVDEGCCYINGSPQNTLVSGVVERAERAGVFVAGDDFKSGQTKLKSVLVDFLVTAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEITKSNVVDDMVESNNILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTLAVHNTCEDSLLATPLILDLALLTELFSRVQLRRDDTEEWQSLHAVLSLVSYLLKAPLVAEGAPVVNALGKQRAAIENMMRACLALRPIHNMQLEHKV 509          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|768442688|ref|XP_011563123.1| (PREDICTED: inositol-3-phosphate synthase [Plutella xylostella])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 426/540 (78.89%), Postives = 477/540 (88.33%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENGDK 540
            MEK  +LVVSSPN+KYT+DYI+S+Y YEE LVTK  +E V  P+  SL +RT +KV KVGVMLVGWGGNNGSTFTAAVLANR QLSWNTKNG MDSNW+GSITQASTVRLGIDEKG +VYIPM Q+LPM+HPDDLVIDGWDISPLNLAESM RA+V+D DLQQKLKKEM+AMKPRPAIYDPDFIAANQADRATNLI+G+K EQY Q+RADI+DFR++ KLDKV VLWTANTER+CDV  GVHDTS+N+EKALRNN+ EISPSTIFA+AAIDEGC YINGSPQNTLVPGV++RAE+ GV VAGDDFKSGQTK+KSVLVDFLV+AGLKP SIVSYNHLGNNDGKNLSAP+QFRSKEISKSNVVDDMV SN ILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTI +HNTCEDSLLA PLILDLVLLA+ +QRVS     S ++T++H V S LSYLLKAP+VP GAPVVNAL  QR AVE ++RACL L P   +QLEHKVPF+M +L SGA+F+     KKQK++H NGD+
Sbjct:    1 MEKAANLVVSSPNLKYTEDYIHSEYKYEEALVTKNEDEVVVTPFSVSLSIRTERKVPKVGVMLVGWGGNNGSTFTAAVLANRQQLSWNTKNGQMDSNWYGSITQASTVRLGIDEKGQEVYIPMSQMLPMVHPDDLVIDGWDISPLNLAESMARAQVLDFDLQQKLKKEMSAMKPRPAIYDPDFIAANQADRATNLIKGSKFEQYQQVRADIRDFREKSKLDKVFVLWTANTERYCDVTVGVHDTSDNIEKALRNNEPEISPSTIFALAAIDEGCCYINGSPQNTLVPGVVDRAERRGVAVAGDDFKSGQTKIKSVLVDFLVAAGLKPTSIVSYNHLGNNDGKNLSAPQQFRSKEISKSNVVDDMVASNSILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIAMHNTCEDSLLATPLILDLVLLAELMQRVSFAPSGSNDYTAMHPVYSILSYLLKAPLVPGGAPVVNALGSQRRAVEGVLRACLSLPPVTCMQLEHKVPFMMKQLRSGALFASCHAAKKQKISHSNGDQ 540          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|512896736|ref|XP_004923981.1| (PREDICTED: inositol-3-phosphate synthase [Bombyx mori])

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 427/540 (79.07%), Postives = 486/540 (90.00%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENGDK 540
            MEK  +LV+ SPNVKY+DD+IY+DY Y ETLV K  N+ VA+PY K+L +RT +KVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNG++D+NWFGSITQASTVRLG+DEKG+DV +PM  LLPM++PDDL IDGWDISPLNLAESM RAKV+D+DLQQKLKKEMA MKPRPAIYDPDFIAANQADRATNLI GTK+EQYLQ+RADIKDF+D+ KLDKVIV+WTANTERFC+VRDGVHDTS+NLEKALR+N+ EISPSTI A+A+IDEGC YING+PQNTL+PGVIERAEK GV VAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKS+VVDD V+SN +LY+PGE+PDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNT+VVHNTCEDSLLA PL+LDL +LA+ L RV++R   +  W +LH  +S L+YLLKAP+VP GAPVVNAL KQRA ++NL+RACLGL   H++QLEHKVPFLM+EL  G+MF+ +P  KK KL  ENGD+
Sbjct:    1 MEKTPNLVIVSPNVKYSDDFIYADYEYNETLVKKIDNQLVAQPYSKTLSIRTQRKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGSLDANWFGSITQASTVRLGLDEKGNDVNVPMNSLLPMVNPDDLFIDGWDISPLNLAESMARAKVLDYDLQQKLKKEMATMKPRPAIYDPDFIAANQADRATNLIHGTKYEQYLQIRADIKDFKDKNKLDKVIVVWTANTERFCEVRDGVHDTSDNLEKALRDNEPEISPSTIIALASIDEGCCYINGAPQNTLIPGVIERAEKRGVFVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSSVVDDAVQSNGVLYRPGERPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTLVVHNTCEDSLLAAPLLLDLAVLAELLGRVALRAGGA--WAALHPALSPLAYLLKAPLVPAGAPVVNALSKQRACIDNLLRACLGLPCLHNMQLEHKVPFLMSELRDGSMFAGAPAFKKPKLDQENGDQ 538          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|357626300|gb|EHJ76435.1| (hypothetical protein KGM_01215 [Danaus plexippus])

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 395/556 (71.04%), Postives = 455/556 (81.83%), Query Frame = 0
Query:    1 MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAY----INGSP----QNTLVPGVIERAEKNGVCVAGDDFKS----GQTK-----LKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENGD 539
            M   ++L VSSPN+KYTDDYI+S Y Y+ETLV    N+ VAKPY  SL +RT ++VGKVGVMLVGWGGNNGSTFTAAV+ANR +L+WNTK+G MDSNW+GSITQASTVRLGIDE+G DVY+ M QLLPM+ P+DLVIDGWDISP+NLA++MVRAKVID+DLQQKL+K+M  MKPRPAIYDPDFIAANQADRA NLIRGT+HEQYLQ+RADIKDFRD+  LDKVIVLWTANTERFC+V  GVHDT+ENL+KAL+ N SE+SPSTIFAMAA+DEG +     + G P         PG +     N V V  + F      G  K      +S   D    + LKPVSIVSYNHLGNNDGKNLSAPKQFRSKEI+KSNVVDDMVE+N++LY  GEKPDHVVVIKYVPYVGDSKRAMDEYTS+ILLHGTNTI VHNTCEDSLLA PLILDL+LLA+   RVS R+++S+EW+ +H V+S+L+YLLKAP+VP GAPVVNALFKQRA +ENL+RACL L P HHLQLEHKVPFLM EL SGAMF    PPKKQKL+H+NGD
Sbjct:    1 MTTTSNLTVSSPNIKYTDDYIFSQYEYQETLVDTVDNKLVAKPYSTSLSIRTDRRVGKVGVMLVGWGGNNGSTFTAAVIANREKLTWNTKDGEMDSNWYGSITQASTVRLGIDERGMDVYVAMSQLLPMVDPNDLVIDGWDISPMNLADAMVRAKVIDYDLQQKLRKKMQTMKPRPAIYDPDFIAANQADRALNLIRGTRHEQYLQIRADIKDFRDKNNLDKVIVLWTANTERFCEVTPGVHDTAENLQKALQQNVSEVSPSTIFAMAAVDEGESRGGLEVKGLPLMREGAGSKPGKVPIEVLNNVNVLLNSFTCPVPVGHVKCLIYSFQSSSFDCRFISSLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEITKSNVVDDMVEANRLLYSEGEKPDHVVVIKYVPYVGDSKRAMDEYTSKILLHGTNTIAVHNTCEDSLLATPLILDLLLLAELFTRVSFRRDESEEWSPMHAVLSSLAYLLKAPLVPAGAPVVNALFKQRANIENLLRACLSLPPLHHLQLEHKVPFLMKELRSGAMF--ESPPKKQKLSHQNGD 554          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|91088055|ref|XP_967186.1| (PREDICTED: inositol-3-phosphate synthase [Tribolium castaneum] >gi|270012832|gb|EFA09280.1| inositol-3-phosphate synthase [Tribolium castaneum])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 349/534 (65.36%), Postives = 422/534 (79.03%), Query Frame = 0
Query:    7 LVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDS--QEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENG 538
            +VV+SP VKY D+YI + Y Y  T   K GN+    P  + L +RT  KV +VGVMLVGWGGNNGSTFTAAVLAN+  LSW TK G   +NW+GS+TQASTVRLG      DVY+P+ +LLP +HPDDLVIDGWDIS  NLAE+M RA+V++  LQQ+LK +MAA+KPRP+IYD DFIAANQA RA N+I+GTK EQ  ++  DI++F+ +  +DKVI+LWTANTERF ++ DG++DT  NL+ A+ +N  EISPST+FA AAI   C YINGSPQNT VPG+IE AEKN V +AGDDFKSGQTK+KSVLVDFLVSAG+KP SIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMV+SN ILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEI++ G NTIVVHNTCEDSLLA P+ILDL++LA+   R+ ++++    +E+   H+V+S LSYL KAP+VP   PVVNALF+QRA +EN+M+ACLGL P  ++ LEHKVPFLM +  S         P K+K+  +NG
Sbjct:    3 IVVNSPKVKYCDNYIETHYDYLYTKAEKRGNKIEVAPVTEHLVIRTESKVPRVGVMLVGWGGNNGSTFTAAVLANKEGLSWQTKKGVQKANWYGSVTQASTVRLG-----GDVYVPLGKLLPTVHPDDLVIDGWDISSANLAEAMERAQVLEPGLQQQLKAKMAALKPRPSIYDQDFIAANQASRADNIIKGTKLEQVQKICQDIENFKKKTNVDKVIILWTANTERFTEIVDGINDTYANLKLAISSNHPEISPSTLFAYAAISMKCTYINGSPQNTFVPGIIEMAEKNNVFIAGDDFKSGQTKIKSVLVDFLVSAGIKPTSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVDSNDILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEIMMGGLNTIVVHNTCEDSLLATPIILDLIILAELCSRIHLKKQGQGDREFVGFHSVLSLLSYLCKAPLVPHNTPVVNALFRQRACIENVMKACLGLPPDSNMLLEHKVPFLMKDEVSNE-------PHKKKIKIQNG 524          
BLAST of HiSeq35287 vs. genbank:protein
Match: gi|907716696|ref|XP_013112333.1| (PREDICTED: inositol-3-phosphate synthase [Stomoxys calcitrans])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 340/534 (63.67%), Postives = 420/534 (78.65%), Query Frame = 0
Query:    4 NTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYV-AKPYRKSLCLRTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFGSITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAESMVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTKHEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEKALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCVAGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQFRSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYTSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQED--SQEWTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPTHHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLA 534
            N +L V SPNV+ T+DYI +DY Y+ + V +  N  +   P   +L +RT ++V K+G+MLVGWGGNNGST TAA+ ANR QL W  + G   +NWFGSITQAST+ +G DE+G DVY PM  L+PM++PDD+++DGWDIS LN+ ESM RA+V+D +LQ +L  +++AMKPRP+IYDPDFIAANQ+DRA NLI+GT++EQY Q+R DI+DF+ +Q LD ++VLWTANTERF DV+ G++ T + LE +L+ N SEISPSTIFAMA+I EGC YINGSPQNT VPG+IE AE  GV +AGDDFKSGQTKLKSVLVDFLV AG+KPVSIVSYNHLGNNDGKNLSAP+QFRSKEISKSNVVDDMVESN +LY+P E PDHVVVIKYVPYVGDSKRAMDEYTSEI++ G NT+V+HNTCEDSLLA PLILDLV+L ++  RV ++     S  W S   V+S LSYL KAP+VP+G+ VVN+LF+QRAA+ENL+R C+GL P  H+ LE +  F        +  +  PP KK K A
Sbjct:    6 NETLEVISPNVQLTEDYIETDYAYQTSNVKRLANGKIQVFPETSNLKIRTDRRVPKLGLMLVGWGGNNGSTLTAALEANRRQLQWRKRTGIQKANWFGSITQASTILIGSDEEGKDVYAPMKDLVPMVNPDDIIVDGWDISSLNIGESMKRAQVLDVELQDQLYADLSAMKPRPSIYDPDFIAANQSDRADNLIKGTRYEQYEQIRKDIQDFKSQQNLDTILVLWTANTERFSDVKPGLNMTMQELESSLKANKSEISPSTIFAMASIAEGCTYINGSPQNTFVPGLIELAEHKGVFIAGDDFKSGQTKLKSVLVDFLVGAGIKPVSIVSYNHLGNNDGKNLSAPQQFRSKEISKSNVVDDMVESNSVLYEPKEHPDHVVVIKYVPYVGDSKRAMDEYTSEIMMGGHNTLVIHNTCEDSLLASPLILDLVILGEFCSRVQIKDNTNVSSNWVSFKPVLSLLSYLCKAPLVPRGSQVVNSLFRQRAAIENLLRGCIGLPPNSHMTLEQRFDF--------SSITNEPPTKKLKTA 531          
The following BLAST results are available for this feature:
BLAST of HiSeq35287 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913303890|ref|XP_013200956.1|0.000e+086.64PREDICTED: inositol-3-phosphate synthase [Amyelois... [more]
gi|910352512|ref|XP_013180218.1|0.000e+082.16PREDICTED: inositol-3-phosphate synthase [Papilio ... [more]
gi|930660333|gb|KPJ02325.1|0.000e+081.97Inositol-3-phosphate synthase [Papilio xuthus][more]
gi|909570820|ref|XP_013140973.1|0.000e+081.78PREDICTED: inositol-3-phosphate synthase [Papilio ... [more]
gi|943956965|ref|XP_014361296.1|0.000e+082.71PREDICTED: inositol-3-phosphate synthase [Papilio ... [more]
gi|768442688|ref|XP_011563123.1|0.000e+078.89PREDICTED: inositol-3-phosphate synthase [Plutella... [more]
gi|512896736|ref|XP_004923981.1|0.000e+079.07PREDICTED: inositol-3-phosphate synthase [Bombyx m... [more]
gi|357626300|gb|EHJ76435.1|0.000e+071.04hypothetical protein KGM_01215 [Danaus plexippus][more]
gi|91088055|ref|XP_967186.1|0.000e+065.36PREDICTED: inositol-3-phosphate synthase [Triboliu... [more]
gi|907716696|ref|XP_013112333.1|0.000e+063.67PREDICTED: inositol-3-phosphate synthase [Stomoxys... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006021 inositol biosynthetic process
biological_process GO:0008654 phospholipid biosynthetic process
molecular_function GO:0004512 inositol-3-phosphate synthase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002587Myo-inositol-1-phosphate synthasePFAMPF07994NAD_binding_5coord: 59..492
e-value: 7.8E-109
score: 363.5
IPR002587Myo-inositol-1-phosphate synthasePIRSFPIRSF015578Myoinositol-ppht_synthcoord: 47..509
e-value: 1.5E-182
score: 604.9
IPR002587Myo-inositol-1-phosphate synthasePANTHERPTHR11510MYO-INOSITOL-1 PHOSPHATE SYNTHASEcoord: 1..517
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 59..308
e-value: 1.7E-104
score: 348.9
coord: 420..494
e-value: 1.7E-104
score: 348.9
NoneNo IPR availableGENE3D3.30.360.10coord: 309..419
e-value: 4.9E-57
score: 190.3
NoneNo IPR availablePANTHERPTHR11510:SF5INOSITOL-3-PHOSPHATE SYNTHASE 1coord: 1..517
NoneNo IPR availableSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 6..306
coord: 419..509
NoneNo IPR availableSUPERFAMILY55347Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domaincoord: 307..419
IPR013021Myo-inositol-1-phosphate synthase, GAPDH-likePFAMPF01658Inos-1-P_synthcoord: 308..421
e-value: 2.3E-46
score: 156.1

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35287HiSeq35287Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35287_p ID=HiSeq35287_p|Name=HiSeq35287|organism=Ostrinia scapulalis|type=polypeptide|length=540bp
MEKNTSLVVSSPNVKYTDDYIYSDYVYEETLVTKTGNEYVAKPYRKSLCL
RTAKKVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNGTMDSNWFG
SITQASTVRLGIDEKGSDVYIPMCQLLPMIHPDDLVIDGWDISPLNLAES
MVRAKVIDHDLQQKLKKEMAAMKPRPAIYDPDFIAANQADRATNLIRGTK
HEQYLQLRADIKDFRDRQKLDKVIVLWTANTERFCDVRDGVHDTSENLEK
ALRNNDSEISPSTIFAMAAIDEGCAYINGSPQNTLVPGVIERAEKNGVCV
AGDDFKSGQTKLKSVLVDFLVSAGLKPVSIVSYNHLGNNDGKNLSAPKQF
RSKEISKSNVVDDMVESNQILYKPGEKPDHVVVIKYVPYVGDSKRAMDEY
TSEILLHGTNTIVVHNTCEDSLLAVPLILDLVLLADWLQRVSVRQEDSQE
WTSLHTVMSTLSYLLKAPMVPQGAPVVNALFKQRAAVENLMRACLGLQPT
HHLQLEHKVPFLMAELASGAMFSPSPPPKKQKLAHENGDK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0008654phospholipid biosynthetic process
GO:0006021inositol biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0004512inositol-3-phosphate synthase activity
Vocabulary: INTERPRO
TermDefinition
IPR013021Myo-inos-1-P_Synthase_GAPDH
IPR016040NAD(P)-bd_dom
IPR002587Myo-inos-1-P_Synthase