HiSeq35288_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq35288
Unique NameHiSeq35288_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length460
Homology
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|910329289|ref|XP_013167896.1| (PREDICTED: bleomycin hydrolase isoform X2 [Papilio xuthus])

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 379/460 (82.39%), Postives = 426/460 (92.61%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            MS++PL+L T  KL + +YA PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKYG+DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNL+NKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR+KV A+AS+ ++Q TID Q+++IY+IVATCLGTPP++F  E+YNKEKAY +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTLQCLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNT+VQ+GL KADRL YGDSCMTHAMVFTAVGTDE GNP KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V + VLEVFKQEAKVLPAWDPMGTLACP+C KE
Sbjct:   23 MSTEPLSLVTLSKLKEKYYADPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYGLDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLINKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDKVSANASEADIQKTIDTQMSVIYHIVATCLGTPPEQFTLEFYNKEKAYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLQCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTEVQVGLNKADRLMYGDSCMTHAMVFTAVGTDEQGNPLKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPESVLEVFKQEAKVLPAWDPMGTLACPVCCKE 482          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|930656659|gb|KPI98983.1| (Bleomycin hydrolase [Papilio xuthus])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 379/460 (82.39%), Postives = 425/460 (92.39%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            MS++PL+L T  KL + +YA PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKYG+DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR+KV A+AS+ ++Q TID Q+++IY+IVATCLGTPP++F  E+YNKEK Y +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTLQCLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNT+VQ+GL KADRL YGDSCMTHAMVFTAVGTDE GNP KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V + VLEVFKQEAKVLPAWDPMGTLACP+C KE
Sbjct:   23 MSTEPLSLVTLSKLKEKYYADPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYGLDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDKVSANASEADIQKTIDTQMSVIYHIVATCLGTPPEQFTLEFYNKEKVYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLQCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTEVQVGLNKADRLMYGDSCMTHAMVFTAVGTDEQGNPLKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPESVLEVFKQEAKVLPAWDPMGTLACPVCCKE 482          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|910329287|ref|XP_013167894.1| (PREDICTED: bleomycin hydrolase isoform X1 [Papilio xuthus])

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 379/460 (82.39%), Postives = 425/460 (92.39%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            + SKPL+L T  KL + +YA PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKYG+DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNL+NKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR+KV A+AS+ ++Q TID Q+++IY+IVATCLGTPP++F  E+YNKEKAY +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTLQCLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNT+VQ+GL KADRL YGDSCMTHAMVFTAVGTDE GNP KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V + VLEVFKQEAKVLPAWDPMGTLACP+C KE
Sbjct:   31 LHSKPLSLVTLSKLKEKYYADPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYGLDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLINKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDKVSANASEADIQKTIDTQMSVIYHIVATCLGTPPEQFTLEFYNKEKAYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLQCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTEVQVGLNKADRLMYGDSCMTHAMVFTAVGTDEQGNPLKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPESVLEVFKQEAKVLPAWDPMGTLACPVCCKE 490          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|1073532569|gb|JAT83396.1| (hypothetical protein g.12802, partial [Pectinophora gossypiella])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 382/460 (83.04%), Postives = 423/460 (91.96%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            MS++PL+LET KKL+DDFY+  KN+LAQN CTR DPFE+AISRRR DSA HVYNI++ESEGKPVTNQENSGRCWLFAALNVMRLPF+KK  I+EFEFSQSYLFFWDKIERSHYWLNNI+ TAK+GE+LDGRL+NFLLKDPINDGGQWDMIVNLVNKYG+VPK+ F ESFSS++SLHMNA+IKTKLRE+A ELR+KV A ASD ++Q TI+KQIA+IYNIVATCLGTPP+KF FE+YNKEKAYQ  G L+PQEFYNKHVRPLFNVDDKVCLV+DPR+SNPFG LYTL CLGNV+GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA DY+L+FNT+VQIG+KKADRL YGDSCMTHAMVFTAVGTD+ GNP +FRVENSY DKEY+KGYLLLTEPWFREFVFE+VVDKKYV   VLEVFKQ   VLPAWDPMGTLACP C KE
Sbjct:   47 MSTEPLSLETLKKLHDDFYSNSKNELAQNVCTRYDPFEVAISRRRADSALHVYNIKVESEGKPVTNQENSGRCWLFAALNVMRLPFMKKNAIEEFEFSQSYLFFWDKIERSHYWLNNIVATAKEGEKLDGRLLNFLLKDPINDGGQWDMIVNLVNKYGVVPKKIFPESFSSRRSLHMNALIKTKLREYAKELRDKVAAKASDADIQGTINKQIAVIYNIVATCLGTPPEKFTFEFYNKEKAYQCMGPLSPQEFYNKHVRPLFNVDDKVCLVNDPRESNPFGKLYTLHCLGNVVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDYRLVFNTEVQIGMKKADRLLYGDSCMTHAMVFTAVGTDDKGNPKRFRVENSYSDKEYDKGYLLLTEPWFREFVFEVVVDKKYVPQAVLEVFKQTPVVLPAWDPMGTLACPCCDKE 506          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|913307486|ref|XP_013184230.1| (PREDICTED: bleomycin hydrolase isoform X1 [Amyelois transitella])

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 378/460 (82.17%), Postives = 425/460 (92.39%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            MSSKPLT++   KL +++Y+ PKN+LAQN CTR DPFE+AISR++TD A HVYNI++ESEGKPVTNQENSGRCWLFAALNVMRLPF+KKY I+EFEFSQSYLFFWDKIERSHYWLNNI+ TAK GEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYG++PK+C+ ESFSSKKSLHMNAIIKTKLRE+A ELR+ V A ASDE +Q  I+KQ+A+I+NIVATCLGTPP+KF FE+YNKEKAY +FG+LTPQEFY +HVRPLFNV+DKVCLVSDPR SNPFGNLYTLQCLGNV+GGR+TAYNNQPIETLM  VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDAHDY+L+FNT+VQIGL+KADRL YGDSCMTHAMVFTAVGT+E G P KFRVENSY DKEY+KGYL+LTEPWFREFVFE+VVDKK+V  EVLEVF+QE KVLPAWDPMGTLACP CS+E
Sbjct:   27 MSSKPLTIDLLGKLRNEYYSDPKNELAQNVCTRFDPFEVAISRKKTDGALHVYNIKVESEGKPVTNQENSGRCWLFAALNVMRLPFMKKYAIEEFEFSQSYLFFWDKIERSHYWLNNIVETAKAGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGVMPKKCYPESFSSKKSLHMNAIIKTKLREYAKELRDMVAAKASDEFIQKAINKQMAVIFNIVATCLGTPPEKFTFEFYNKEKAYNNFGALTPQEFYEQHVRPLFNVNDKVCLVSDPRQSNPFGNLYTLQCLGNVVGGRRTAYNNQPIETLMNVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAHDYRLVFNTEVQIGLQKADRLMYGDSCMTHAMVFTAVGTNEQGKPYKFRVENSYSDKEYDKGYLMLTEPWFREFVFEVVVDKKFVPKEVLEVFQQEPKVLPAWDPMGTLACPYCSRE 486          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|909552126|ref|XP_013144067.1| (PREDICTED: bleomycin hydrolase isoform X2 [Papilio polytes])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 377/460 (81.96%), Postives = 421/460 (91.52%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            MS++PL L T  KL + +Y  PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKY +DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR++V A A+D ++Q TIDKQ+A+IY+IVATCLGTPP++F  E+YNKEK Y +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTL CLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNT+VQ+GL KADRL YGDSCMTHAMVFTAVGTDE GNP KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V D VLEVFKQEAKVLPAWDPMGTLACP+C K+
Sbjct:   23 MSTEPLNLATLSKLKEKYYEDPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYALDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDQVCAQATDADIQKTIDKQMAVIYHIVATCLGTPPEQFTLEFYNKEKVYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLHCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTEVQVGLNKADRLMYGDSCMTHAMVFTAVGTDEQGNPLKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPDSVLEVFKQEAKVLPAWDPMGTLACPVCCKD 482          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|909552124|ref|XP_013144059.1| (PREDICTED: bleomycin hydrolase isoform X1 [Papilio polytes])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 377/460 (81.96%), Postives = 420/460 (91.30%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            + SKPL L T  KL + +Y  PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKY +DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR++V A A+D ++Q TIDKQ+A+IY+IVATCLGTPP++F  E+YNKEK Y +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTL CLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNT+VQ+GL KADRL YGDSCMTHAMVFTAVGTDE GNP KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V D VLEVFKQEAKVLPAWDPMGTLACP+C K+
Sbjct:   31 LHSKPLNLATLSKLKEKYYEDPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYALDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDQVCAQATDADIQKTIDKQMAVIYHIVATCLGTPPEQFTLEFYNKEKVYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLHCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTEVQVGLNKADRLMYGDSCMTHAMVFTAVGTDEQGNPLKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPDSVLEVFKQEAKVLPAWDPMGTLACPVCCKD 490          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|943961207|ref|XP_014363108.1| (PREDICTED: bleomycin hydrolase [Papilio machaon])

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 378/460 (82.17%), Postives = 422/460 (91.74%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            MS++PL+L T  KL + +YA PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKYG+DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR+KV A+ASD ++Q TID Q+++IY+IVATCLGTPP++F  E+YNKEK Y +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTLQCLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNTDVQ+GL KADRL YGDSCMTHAMVFTAVGTD L    KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V + VLEVFKQEAKVLPAWDPMGTLACP+C KE
Sbjct:   23 MSTEPLSLVTLSKLKEKYYADPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYGLDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDKVSANASDADIQKTIDSQMSVIYHIVATCLGTPPEQFTLEFYNKEKVYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLQCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTDVQVGLNKADRLMYGDSCMTHAMVFTAVGTDVL---LKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPESVLEVFKQEAKVLPAWDPMGTLACPVCCKE 479          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|930670815|gb|KPJ11626.1| (Bleomycin hydrolase [Papilio machaon])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 378/460 (82.17%), Postives = 421/460 (91.52%), Query Frame = 0
Query:    1 MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            + SKPL+L T  KL + +YA PKN+LAQNACTR DPFE+AI RR+ DS  HVYNI+LESEGKPVTNQEN+GRCWLFAALNVMRLPF+KKYG+DEFEFSQ YLFFWDKIERSHYWLNNI+ TA+QGEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYGL+PK+CF ESFSS++SLHMNAIIKTKLREFA ELR+KV A+ASD ++Q TID Q+++IY+IVATCLGTPP++F  E+YNKEK Y +FG L+PQEFYNKHVRPLFNVDDKVCLVSDPR SNPFGNLYTLQCLGN++GGRQTAYNNQPIETLMK VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDA D+KL+FNTDVQ+GL KADRL YGDSCMTHAMVFTAVGTD L    KFRVENSYGDKEY+KGYLLLT PWF+EFVFE+VVDKK+V + VLEVFKQEAKVLPAWDPMGTLACP+C KE
Sbjct:    6 LHSKPLSLVTLSKLKEKYYADPKNELAQNACTRFDPFEVAIRRRQADSTLHVYNIKLESEGKPVTNQENTGRCWLFAALNVMRLPFMKKYGLDEFEFSQGYLFFWDKIERSHYWLNNIVQTARQGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGLMPKKCFPESFSSRRSLHMNAIIKTKLREFAKELRDKVSANASDADIQKTIDSQMSVIYHIVATCLGTPPEQFTLEFYNKEKVYNNFGPLSPQEFYNKHVRPLFNVDDKVCLVSDPRQSNPFGNLYTLQCLGNMVGGRQTAYNNQPIETLMKVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAQDFKLVFNTDVQVGLNKADRLMYGDSCMTHAMVFTAVGTDVL---LKFRVENSYGDKEYDKGYLLLTTPWFKEFVFEVVVDKKFVPESVLEVFKQEAKVLPAWDPMGTLACPVCCKE 462          
BLAST of HiSeq35288 vs. genbank:protein
Match: gi|913307488|ref|XP_013184231.1| (PREDICTED: bleomycin hydrolase isoform X2 [Amyelois transitella])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 374/458 (81.66%), Postives = 423/458 (92.36%), Query Frame = 0
Query:    3 SKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSASHVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQSYLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMIVNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADASDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTPQEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAYNNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIFNTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDKEYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMGTLACPLCSKE 460
            ++PLT++   KL +++Y+ PKN+LAQN CTR DPFE+AISR++TD A HVYNI++ESEGKPVTNQENSGRCWLFAALNVMRLPF+KKY I+EFEFSQSYLFFWDKIERSHYWLNNI+ TAK GEEL+GRLVNFLLKDPINDGGQWDMIVNLVNKYG++PK+C+ ESFSSKKSLHMNAIIKTKLRE+A ELR+ V A ASDE +Q  I+KQ+A+I+NIVATCLGTPP+KF FE+YNKEKAY +FG+LTPQEFY +HVRPLFNV+DKVCLVSDPR SNPFGNLYTLQCLGNV+GGR+TAYNNQPIETLM  VKDSIQGGEAVWFGCEVSKRFERK+GLEDLDAHDY+L+FNT+VQIGL+KADRL YGDSCMTHAMVFTAVGT+E G P KFRVENSY DKEY+KGYL+LTEPWFREFVFE+VVDKK+V  EVLEVF+QE KVLPAWDPMGTLACP CS+E
Sbjct:    2 AEPLTIDLLGKLRNEYYSDPKNELAQNVCTRFDPFEVAISRKKTDGALHVYNIKVESEGKPVTNQENSGRCWLFAALNVMRLPFMKKYAIEEFEFSQSYLFFWDKIERSHYWLNNIVETAKAGEELEGRLVNFLLKDPINDGGQWDMIVNLVNKYGVMPKKCYPESFSSKKSLHMNAIIKTKLREYAKELRDMVAAKASDEFIQKAINKQMAVIFNIVATCLGTPPEKFTFEFYNKEKAYNNFGALTPQEFYEQHVRPLFNVNDKVCLVSDPRQSNPFGNLYTLQCLGNVVGGRRTAYNNQPIETLMNVVKDSIQGGEAVWFGCEVSKRFERKNGLEDLDAHDYRLVFNTEVQIGLQKADRLMYGDSCMTHAMVFTAVGTNEQGKPYKFRVENSYSDKEYDKGYLMLTEPWFREFVFEVVVDKKFVPKEVLEVFQQEPKVLPAWDPMGTLACPYCSRE 459          
The following BLAST results are available for this feature:
BLAST of HiSeq35288 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910329289|ref|XP_013167896.1|0.000e+082.39PREDICTED: bleomycin hydrolase isoform X2 [Papilio... [more]
gi|930656659|gb|KPI98983.1|0.000e+082.39Bleomycin hydrolase [Papilio xuthus][more]
gi|910329287|ref|XP_013167894.1|0.000e+082.39PREDICTED: bleomycin hydrolase isoform X1 [Papilio... [more]
gi|1073532569|gb|JAT83396.1|0.000e+083.04hypothetical protein g.12802, partial [Pectinophor... [more]
gi|913307486|ref|XP_013184230.1|0.000e+082.17PREDICTED: bleomycin hydrolase isoform X1 [Amyeloi... [more]
gi|909552126|ref|XP_013144067.1|0.000e+081.96PREDICTED: bleomycin hydrolase isoform X2 [Papilio... [more]
gi|909552124|ref|XP_013144059.1|0.000e+081.96PREDICTED: bleomycin hydrolase isoform X1 [Papilio... [more]
gi|943961207|ref|XP_014363108.1|0.000e+082.17PREDICTED: bleomycin hydrolase [Papilio machaon][more]
gi|930670815|gb|KPJ11626.1|0.000e+082.17Bleomycin hydrolase [Papilio machaon][more]
gi|913307488|ref|XP_013184231.1|0.000e+081.66PREDICTED: bleomycin hydrolase isoform X2 [Amyeloi... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004197 cysteine-type endopeptidase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004134Peptidase C1B, bleomycin hydrolasePIRSFPIRSF005700PepCcoord: 2..454
e-value: 1.4E-167
score: 555.7
IPR004134Peptidase C1B, bleomycin hydrolasePFAMPF03051Peptidase_C1_2coord: 6..450
e-value: 3.2E-176
score: 586.0
IPR004134Peptidase C1B, bleomycin hydrolasePANTHERPTHR10363BLEOMYCIN HYDROLASEcoord: 6..454
NoneNo IPR availableGENE3D3.90.70.10coord: 56..453
e-value: 6.2E-163
score: 541.9
NoneNo IPR availableSUPERFAMILY54001Cysteine proteinasescoord: 6..452
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 67..78

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq35288HiSeq35288Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq35288_p ID=HiSeq35288_p|Name=HiSeq35288|organism=Ostrinia scapulalis|type=polypeptide|length=460bp
MSSKPLTLETTKKLNDDFYAQPKNQLAQNACTRTDPFEIAISRRRTDSAS
HVYNIRLESEGKPVTNQENSGRCWLFAALNVMRLPFVKKYGIDEFEFSQS
YLFFWDKIERSHYWLNNIITTAKQGEELDGRLVNFLLKDPINDGGQWDMI
VNLVNKYGLVPKECFKESFSSKKSLHMNAIIKTKLREFAMELREKVKADA
SDEELQATIDKQIAIIYNIVATCLGTPPDKFNFEYYNKEKAYQSFGSLTP
QEFYNKHVRPLFNVDDKVCLVSDPRDSNPFGNLYTLQCLGNVIGGRQTAY
NNQPIETLMKAVKDSIQGGEAVWFGCEVSKRFERKHGLEDLDAHDYKLIF
NTDVQIGLKKADRLRYGDSCMTHAMVFTAVGTDELGNPTKFRVENSYGDK
EYNKGYLLLTEPWFREFVFEIVVDKKYVADEVLEVFKQEAKVLPAWDPMG
TLACPLCSKE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: Molecular Function
TermDefinition
GO:0004197cysteine-type endopeptidase activity
Vocabulary: INTERPRO
TermDefinition
IPR000169Pept_cys_AS
IPR004134Peptidase_C1B