HiSeq37914_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq37914
Unique NameHiSeq37914_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length421
Homology
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|768429404|ref|XP_011555881.1| (PREDICTED: TBC1 domain family member 20-like [Plutella xylostella])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 317/424 (74.76%), Postives = 352/424 (83.02%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQ-EFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLEEERLKRRQAAVRARNNPSLTTRLSRRLARALPAL--ASRRTLLATATVLLGVYVYYRPDLLFNR 421
            MES   D    DKCN NGDCS PP+     +N+ +NIDDISTPSELKFDQ E   EDP+ITEK++ IEKCL DP++  LE+W+ LAKSKGGLI D+YR+ IW  LVGVTK+EMT+PPSLDELSTH EYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG VSSFP+LCRLSHG  APLAPFMQ TM+PTQH LNYMLP++ R D + AD LDK+QVGTMFALPWYLTWFGHSLN YS VVRLYDYFLCAPPLFPVYVTAAIVA R  E+ A ECDMA+LHCLLSRLPDDLPFEDILVTA +LY+E+DP  LE EV   E++EEEQR+L+EER++RRQ A R   NP+L  RL RRL R L      S RT+LATATVL+GVY YYRPD LFNR
Sbjct:    1 MESITPDLSPEDKCNFNGDCSPPPRNSIHELNYNRNIDDISTPSELKFDQDEDEIEDPEITEKKKLIEKCLQDPNT-TLEQWKYLAKSKGGLILDEYRRKIWHQLVGVTKDEMTEPPSLDELSTHSEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDVSSFPLLCRLSHGEAAPLAPFMQLTMRPTQHRLNYMLPIVRRIDAELADYLDKSQVGTMFALPWYLTWFGHSLNAYSAVVRLYDYFLCAPPLFPVYVTAAIVAQRAPELLAAECDMAVLHCLLSRLPDDLPFEDILVTADQLYKEHDPSTLEEEVILFEKKEEEQRKLDEERMRRRQIAARNARNPTLYVRLERRLKRWLNMRLPLSYRTVLATATVLVGVYAYYRPDFLFNR 423          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|768448913|ref|XP_011566513.1| (PREDICTED: TBC1 domain family member 20-like [Plutella xylostella])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 312/424 (73.58%), Postives = 349/424 (82.31%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQ-EFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLEEERLKRRQAAVRARNNPSLTTRLSRRLARALPAL--ASRRTLLATATVLLGVYVYYRPDLLFNR 421
            MES   D    DKCN NGDCS PP+     +N+ +NIDDISTPSELKFDQ E   EDP+ITEK++ IEKCL DP++  LE+W+ LAKSKGGLI D+YR+ IW  LVGVTK+EMT+PPSLDELSTH EYNQVVLDVNRSLKRFPPGIPYEQRVA Q QLTVLILRV+IKYPHLKYYQGYHDVAITLLLVCG VSSFP+LCRLSHG  APLAPFMQ TM+PTQH LNYMLP++ R D + AD LDK+QVGTMFALPWYLTWFGHS+N YS VVRLYDYFLCA PLFPVYVTAAIVA R  E+ A ECDMA+LHCLLSRLPDDLPFEDILVTA +LY+E+DP  LE EV   E++EEEQR+L+EER++RRQ A R   NP+L  RL RRL R L      S RT+LATATVL+GVY YYRPD LFNR
Sbjct:    1 MESITPDLSPEDKCNFNGDCSPPPRNSIHELNYNRNIDDISTPSELKFDQDEDEIEDPEITEKKKLIEKCLQDPNT-TLEQWKYLAKSKGGLILDEYRRKIWHQLVGVTKDEMTEPPSLDELSTHSEYNQVVLDVNRSLKRFPPGIPYEQRVAPQGQLTVLILRVLIKYPHLKYYQGYHDVAITLLLVCGDVSSFPLLCRLSHGEAAPLAPFMQLTMRPTQHRLNYMLPIVRRIDAELADYLDKSQVGTMFALPWYLTWFGHSMNAYSAVVRLYDYFLCATPLFPVYVTAAIVAQRAPELLAAECDMAVLHCLLSRLPDDLPFEDILVTADQLYKEHDPSTLEEEVILFEKKEEEQRKLDEERMRRRQIAARNARNPTLYVRLERRLKRWLNMRLPLSYRTVLATATVLVGVYAYYRPDFLFNR 423          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|357607471|gb|EHJ65512.1| (hypothetical protein KGM_19705 [Danaus plexippus])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 291/359 (81.06%), Postives = 317/359 (88.30%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLE 359
            MES   D++  DKCN+NGDCS      + N NHAKNIDDISTPSELKFD++  FE  DI EKR+ IEKCL++PD VNLE+WQN AKSKGGLI D YR+ IWPLLVGVT+EE+TDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS+G  APLAPFMQTTMQPTQHLLNYMLP+L RAD   ADCLDKA VGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTA+IV  R  +V  C+CDMAM+HCLLSRLPDDLPFEDILVTA+K+Y ENDP DLE EVAALE+REEEQR+L+
Sbjct:    1 MESINTDSERSDKCNINGDCSPITDNESNNFNHAKNIDDISTPSELKFDEDLEFESFDIIEKRKDIEKCLANPDLVNLEQWQNFAKSKGGLICDKYRRKIWPLLVGVTQEELTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDRASFPLLCRLSYGSGAPLAPFMQTTMQPTQHLLNYMLPILRRADHGLADCLDKAGVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTASIVLQRAADVYQCDCDMAMMHCLLSRLPDDLPFEDILVTAEKIYNENDPTDLEDEVAALEKREEEQRKLD 359          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|910349509|ref|XP_013178781.1| (PREDICTED: TBC1 domain family member 20 [Papilio xuthus])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 304/391 (77.75%), Postives = 342/391 (87.47%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLEEERLKRRQAAVRARNNPS--LTTRLSRRLARA 389
            ME    ++++GD CNLNG+CS P K  + ++NHAKNIDDISTPSELKFD++F FEDPD+T KR+ +EKCL +PD VN+E+WQ+ AKSKGGLI+D+YR+ IWPLLVGVT++EMT+PPSLDELSTH EYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS+GP APLAPFMQTTMQPTQHLLNYMLPVL RAD   ADCLDKA VGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAA+V +R   V AC+ DMAM+HCLLSRLPDDLPFEDILVTAKKLY+ENDP DLE EV ALERREEEQRRL+EERL++R+     RN  +  +  RL R L R+
Sbjct:    1 MEDKNQESNIGDTCNLNGNCSPPTKNISIDLNHAKNIDDISTPSELKFDEDFEFEDPDVTAKRKEMEKCLENPDIVNIEKWQSFAKSKGGLIADEYRRRIWPLLVGVTRDEMTEPPSLDELSTHVEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDKASFPLLCRLSYGPTAPLAPFMQTTMQPTQHLLNYMLPVLRRADDKLADCLDKAGVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAALVLHRAPAVYACDVDMAMMHCLLSRLPDDLPFEDILVTAKKLYDENDPTDLEAEVDALERREEEQRRLDEERLRQRRVERAGRNRAANGVLARLRRVLPRS 391          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|930663156|gb|KPJ04759.1| (TBC1 domain family member 20 [Papilio xuthus])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 303/391 (77.49%), Postives = 341/391 (87.21%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLEEERLKRRQAAVRARNNPS--LTTRLSRRLARA 389
            ME    ++++GD CNLNG+CS P K  + ++NHAKNIDDISTPSELKFD++F FEDPD+T KR+ +EKCL +PD VN+E+WQ+ AKSK GLI+D+YR+ IWPLLVGVT++EMT+PPSLDELSTH EYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS+GP APLAPFMQTTMQPTQHLLNYMLPVL RAD   ADCLDKA VGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAA+V +R   V AC+ DMAM+HCLLSRLPDDLPFEDILVTAKKLY+ENDP DLE EV ALERREEEQRRL+EERL++R+     RN  +  +  RL R L R+
Sbjct:    1 MEDKNQESNIGDTCNLNGNCSPPTKNISIDLNHAKNIDDISTPSELKFDEDFEFEDPDVTAKRKEMEKCLENPDIVNIEKWQSFAKSKAGLIADEYRRRIWPLLVGVTRDEMTEPPSLDELSTHVEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDKASFPLLCRLSYGPTAPLAPFMQTTMQPTQHLLNYMLPVLRRADDKLADCLDKAGVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAALVLHRAPAVYACDVDMAMMHCLLSRLPDDLPFEDILVTAKKLYDENDPTDLEAEVDALERREEEQRRLDEERLRQRRVERAGRNRAANGVLARLRRVLPRS 391          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|930665973|gb|KPJ07097.1| (TBC1 domain family member 20 [Papilio machaon])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 301/391 (76.98%), Postives = 340/391 (86.96%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLEEERLKRRQAAVRARNNPS--LTTRLSRRLARA 389
            ME    ++++GD CNLNG+CS P K  + N+NH KNIDDISTPSELKFD++F FEDPD+T KR+ +E CL +PD VN+E+WQ+ AKSKGGLI+D+YR+ IWPLLVGVT++EMT+PPSLDELSTH EYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS+GP APLAPFMQTTMQPTQHLLNYMLPV+ RAD   ADCLDKA VGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAA+V +R   V AC+ DMAM+HCLLSRLPDDLPFEDILVTAKKLY+ENDP DLE EV ALERREEEQRR++EERL++R+     RN  +  +  RL R L R+
Sbjct:    1 MEDKNQESNIGDTCNLNGNCSPPTKNISINLNHGKNIDDISTPSELKFDEDFEFEDPDVTAKRKEMEICLENPDIVNIEKWQSFAKSKGGLIADEYRRRIWPLLVGVTRDEMTEPPSLDELSTHVEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDKASFPLLCRLSYGPTAPLAPFMQTTMQPTQHLLNYMLPVIRRADDKLADCLDKAGVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAALVLHRAPAVYACDVDMAMMHCLLSRLPDDLPFEDILVTAKKLYDENDPTDLEGEVDALERREEEQRRIDEERLRQRRVERAGRNRAANGVLARLRRVLPRS 391          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|943975818|ref|XP_014369069.1| (PREDICTED: TBC1 domain family member 20 [Papilio machaon])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 301/391 (76.98%), Postives = 340/391 (86.96%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQRRLEEERLKRRQAAVRARNNPS--LTTRLSRRLARA 389
            ME    ++++GD CNLNG+CS P K  + N+NH KNIDDISTPSELKFD++F FEDPD+T KR+ +E CL +PD VN+E+WQ+ AKSKGGLI+D+YR+ IWPLLVGVT++EMT+PPSLDELSTH EYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS+GP APLAPFMQTTMQPTQHLLNYMLPV+ RAD   ADCLDKA VGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAA+V +R   V AC+ DMAM+HCLLSRLPDDLPFEDILVTAKKLY+ENDP DLE EV ALERREEEQRR++EERL++R+     RN  +  +  RL R L R+
Sbjct:    1 MEDKNQESNIGDTCNLNGNCSPPTKNISINLNHGKNIDDISTPSELKFDEDFEFEDPDVTAKRKEMEICLENPDIVNIEKWQSFAKSKGGLIADEYRRRIWPLLVGVTRDEMTEPPSLDELSTHVEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDKASFPLLCRLSYGPTAPLAPFMQTTMQPTQHLLNYMLPVIRRADDKLADCLDKAGVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAALVLHRAPAVYACDVDMAMMHCLLSRLPDDLPFEDILVTAKKLYDENDPTDLEGEVDALERREEEQRRIDEERLRQRRVERAGRNRAANGVLARLRRVLPRS 391          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|913312555|ref|XP_013187009.1| (PREDICTED: TBC1 domain family member 20 [Amyelois transitella])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 313/421 (74.35%), Postives = 350/421 (83.14%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEV--AALERREEEQRRLEEERLKRRQAAVRARNNPSLTTRLSRRLARALP-ALASRRTLLATATVLLGVYVYYRPDLL 418
            ME N  D D+GD CNLNGDCSSP KK  F+ NH KNIDDIS+PSELKFD E   EDP+IT KR+ IE C++DPDSV+ ++W++ A S GGLI D+YRK IWPLLVGVTKEEMTDPPSLDELSTH EY+QVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVII+YPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS G  APLAPFMQ TMQPTQHLLNYMLPV+ RA++  ADCL+KA VGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIV +R +EV  C+CDMAM+HCLLSRLPDDLPFEDILVTAKKLY++NDP +LE EV        E+ ++  EE   +R+ AA  AR   S   RL+RRLAR +P AL +R   LA ATVLLGVYVYYRPD+ 
Sbjct:    1 MEPNNTDADIGDTCNLNGDCSSPAKKQVFDPNHTKNIDDISSPSELKFDLEKEIEDPEITAKRKEIEACIADPDSVDYQQWKSFAVSTGGLICDEYRKVIWPLLVGVTKEEMTDPPSLDELSTHQEYSQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIEYPHLKYYQGYHDVAITLLLVCGDRASFPLLCRLSCGAGAPLAPFMQLTMQPTQHLLNYMLPVIARAEKKLADCLEKAGVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVLHRAEEVYVCDCDMAMMHCLLSRLPDDLPFEDILVTAKKLYDKNDPSELEMEVYELERREEEQRRQEEEERLRRRQLAARNARAAASPARRLARRLARCVPAALRTRGAALAAATVLLGVYVYYRPDVF 421          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|827546168|ref|XP_012545540.1| (PREDICTED: TBC1 domain family member 20, partial [Bombyx mori])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 275/355 (77.46%), Postives = 307/355 (86.48%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERREEEQ 355
            MESN  D++V DK  +NG+CS        N+N  KNID ISTPSELKFD E   EDP+I EKR+ IE+CLSD DSV++E+W+NLA+SKGGLI D+YR+ IWPLLVGVTKEEMT+ PSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCG  +SFP+LCRLS+G  APLAPFMQ TMQPTQHLLNYMLPV+ RA+   A+ L++A VGTMFALPWYLTWFGHSL RY+ VVRLYDYFLCAPPLFPVYVTAA+V  R DEV  CE DMAMLHCLLS+LPDDLPFEDILVTA++LYE NDP+DLE EV ALE++EEEQ
Sbjct:    1 MESNNKDSEVIDKSVMNGECSPAKSIHPTNLNKTKNIDVISTPSELKFDNEPEEEDPEIVEKRKEIEECLSDVDSVDVEKWKNLARSKGGLICDEYRRRIWPLLVGVTKEEMTEAPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGDRASFPLLCRLSYGAGAPLAPFMQLTMQPTQHLLNYMLPVVGRANTKLANRLEEAGVGTMFALPWYLTWFGHSLGRYALVVRLYDYFLCAPPLFPVYVTAAVVLCRADEVFECELDMAMLHCLLSKLPDDLPFEDILVTAQELYENNDPLDLEDEVVALEQKEEEQ 355          
BLAST of HiSeq37914 vs. genbank:protein
Match: gi|914572536|gb|KOB75370.1| (Uncharacterized protein OBRU01_07861 [Operophtera brumata])

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 256/352 (72.73%), Postives = 279/352 (79.26%), Query Frame = 0
Query:    1 MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQEFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTIWPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRLSHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMFALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVRACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALERRE 352
            M+SN  D D GDKCN NG CS   +K    +NHAKNIDDISTPSELKFDQEF++EDPDITEKR+ IEKCL DPDSVNLE+WQ+ A SKGGLISD++R+ IWPLLVGV                       VLDVNRSLKRFPPGIPY QRVALQDQLTVLILRVI+KYPHLKYYQGYHDVAITLLLVCGS +SFP+LCRLSHG  APLAPFMQ TMQPTQHLLNYMLPV+ RA+++ A+ LDKA VGTMFALPWYLTWFGHSL RY+DVVRLYDYFLCAPPLFPVYVTAA+V +R  EV  CECDMAMLHCLLSR               KLYEEN+P DLE EVAALERRE
Sbjct:    1 MDSNKTDADSGDKCNSNGKCSPTLRKLPIELNHAKNIDDISTPSELKFDQEFDYEDPDITEKRKEIEKCLQDPDSVNLEQWQDFATSKGGLISDEFRRKIWPLLVGV-----------------------VLDVNRSLKRFPPGIPYLQRVALQDQLTVLILRVIMKYPHLKYYQGYHDVAITLLLVCGSRASFPLLCRLSHGAGAPLAPFMQVTMQPTQHLLNYMLPVVARAEKELAEYLDKAGVGTMFALPWYLTWFGHSLTRYTDVVRLYDYFLCAPPLFPVYVTAALVVHRALEVYTCECDMAMLHCLLSR---------------KLYEENNPTDLEKEVAALERRE 314          
The following BLAST results are available for this feature:
BLAST of HiSeq37914 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|768429404|ref|XP_011555881.1|0.000e+074.76PREDICTED: TBC1 domain family member 20-like [Plut... [more]
gi|768448913|ref|XP_011566513.1|0.000e+073.58PREDICTED: TBC1 domain family member 20-like [Plut... [more]
gi|357607471|gb|EHJ65512.1|0.000e+081.06hypothetical protein KGM_19705 [Danaus plexippus][more]
gi|910349509|ref|XP_013178781.1|0.000e+077.75PREDICTED: TBC1 domain family member 20 [Papilio x... [more]
gi|930663156|gb|KPJ04759.1|0.000e+077.49TBC1 domain family member 20 [Papilio xuthus][more]
gi|930665973|gb|KPJ07097.1|0.000e+076.98TBC1 domain family member 20 [Papilio machaon][more]
gi|943975818|ref|XP_014369069.1|0.000e+076.98PREDICTED: TBC1 domain family member 20 [Papilio m... [more]
gi|913312555|ref|XP_013187009.1|0.000e+074.35PREDICTED: TBC1 domain family member 20 [Amyelois ... [more]
gi|827546168|ref|XP_012545540.1|0.000e+077.46PREDICTED: TBC1 domain family member 20, partial [... [more]
gi|914572536|gb|KOB75370.1|0.000e+072.73Uncharacterized protein OBRU01_07861 [Operophtera ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 348..372
NoneNo IPR availableGENE3D1.10.8.270coord: 92..200
e-value: 7.8E-9
score: 34.9
NoneNo IPR availablePANTHERPTHR20913TBC1 DOMAIN FAMILY MEMBER 20/GTPASEcoord: 16..352
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 394..413
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..393
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 414..421
IPR000195Rab-GTPase-TBC domainSMARTSM00164TBCcoord: 88..303
e-value: 2.4E-4
score: 11.6
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 94..295
e-value: 2.0E-23
score: 82.8
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 91..280
score: 19.172
IPR000195Rab-GTPase-TBC domainSUPERFAMILY47923Ypt/Rab-GAP domain of gyp1pcoord: 216..334
IPR000195Rab-GTPase-TBC domainSUPERFAMILY47923Ypt/Rab-GAP domain of gyp1pcoord: 73..231

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq37914HiSeq37914Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq37914_p ID=HiSeq37914_p|Name=HiSeq37914|organism=Ostrinia scapulalis|type=polypeptide|length=421bp
MESNLIDTDVGDKCNLNGDCSSPPKKPAFNMNHAKNIDDISTPSELKFDQ
EFNFEDPDITEKRRGIEKCLSDPDSVNLEEWQNLAKSKGGLISDDYRKTI
WPLLVGVTKEEMTDPPSLDELSTHPEYNQVVLDVNRSLKRFPPGIPYEQR
VALQDQLTVLILRVIIKYPHLKYYQGYHDVAITLLLVCGSVSSFPMLCRL
SHGPRAPLAPFMQTTMQPTQHLLNYMLPVLMRADRDAADCLDKAQVGTMF
ALPWYLTWFGHSLNRYSDVVRLYDYFLCAPPLFPVYVTAAIVAYRGDEVR
ACECDMAMLHCLLSRLPDDLPFEDILVTAKKLYEENDPVDLEPEVAALER
REEEQRRLEEERLKRRQAAVRARNNPSLTTRLSRRLARALPALASRRTLL
ATATVLLGVYVYYRPDLLFNR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR000195Rab-GTPase-TBC_dom