HiSeq38294_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq38294
Unique NameHiSeq38294_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length460
Homology
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|910354046|ref|XP_013181068.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 2-like isoform X2 [Papilio xuthus])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 422/460 (91.74%), Postives = 434/460 (94.35%), Query Frame = 0
Query:    1 MILYDLQIEAGAGEGPGPPANNNAEGAAGAQRDDNHNAPNPPTPPTPRVTQLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            MILY LQIE GAGEGPGPP NNNAEGAA + RDDNHNA   P    PRV  LTPSE LK Y ERL+EWER E+RKYPEVWF+GLEANKVQAR+NLPNNCGFDDENGSYNKQ+HDHIAYRYEILEVIGKGSFGQVIRALDHRT HQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYG PIDMWSMGCILAELHTGYPLFPGENEAEQLACIME+LGPPPPDLLLHATRKRLFFDSKG PR+VTNSKGRKRRPGSR L+ AVRTDDPAFLHF+HRCLEWDPKRRITPTEATRHEFVTGCALGT+ +GVLALPRLAPPRP R ALLHSQSAGDVAAMLGRA
Sbjct:    1 MILYGLQIE-GAGEGPGPP-NNNAEGAAASPRDDNHNAAQQP----PRVP-LTPSEVLKAYGERLTEWERNEVRKYPEVWFVGLEANKVQARANLPNNCGFDDENGSYNKQMHDHIAYRYEILEVIGKGSFGQVIRALDHRTGHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGAPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMEVLGPPPPDLLLHATRKRLFFDSKGCPRTVTNSKGRKRRPGSRALSAAVRTDDPAFLHFIHRCLEWDPKRRITPTEATRHEFVTGCALGTSTTGVLALPRLAPPRPARAALLHSQSAGDVAAMLGRA 453          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|910354044|ref|XP_013181067.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 2-like isoform X1 [Papilio xuthus])

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 418/455 (91.87%), Postives = 430/455 (94.51%), Query Frame = 0
Query:    6 LQIEAGAGEGPGPPANNNAEGAAGAQRDDNHNAPNPPTPPTPRVTQLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            LQIE GAGEGPGPP NNNAEGAA + RDDNHNA   P    PRV  LTPSE LK Y ERL+EWER E+RKYPEVWF+GLEANKVQAR+NLPNNCGFDDENGSYNKQ+HDHIAYRYEILEVIGKGSFGQVIRALDHRT HQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYG PIDMWSMGCILAELHTGYPLFPGENEAEQLACIME+LGPPPPDLLLHATRKRLFFDSKG PR+VTNSKGRKRRPGSR L+ AVRTDDPAFLHF+HRCLEWDPKRRITPTEATRHEFVTGCALGT+ +GVLALPRLAPPRP R ALLHSQSAGDVAAMLGRA
Sbjct:   13 LQIE-GAGEGPGPP-NNNAEGAAASPRDDNHNAAQQP----PRVP-LTPSEVLKAYGERLTEWERNEVRKYPEVWFVGLEANKVQARANLPNNCGFDDENGSYNKQMHDHIAYRYEILEVIGKGSFGQVIRALDHRTGHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGAPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMEVLGPPPPDLLLHATRKRLFFDSKGCPRTVTNSKGRKRRPGSRALSAAVRTDDPAFLHFIHRCLEWDPKRRITPTEATRHEFVTGCALGTSTTGVLALPRLAPPRPARAALLHSQSAGDVAAMLGRA 460          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|909582202|ref|XP_013147120.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 2 [Papilio polytes])

HSP 1 Score: 803.512 bits (2074), Expect = 0.000e+0
Identity = 414/455 (90.99%), Postives = 429/455 (94.29%), Query Frame = 0
Query:    6 LQIEAGAGEGPGPPANNNAEGAAGAQRDDNHNAPNPPTPPTPRVTQLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            LQIE GAGEGPGPP NNNAEGAA + RDDNHNA   P    PRV  +TPSE LK Y ERL++WER E+RKYPEVWF+GLEANKVQAR+NLPNNCGFDDENGSYNKQ+HDHIAYRYEILEVIGKGSFGQVIRALDHRT +QVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYG PIDMWSMGCILAELHTGYPLFPGENEAEQLACIME+LGPPPPDLLLHATRKRLFFDSKG PR+VTNSKGRKRRPGSR L+ AVRTDDPAFLHF+HRCLEWDPKRRITPTEATRHEFVTGCALGT+ +GVLALPRLAPPRP   ALLHSQSAGDVAAMLGRA
Sbjct:   13 LQIE-GAGEGPGPP-NNNAEGAAASPRDDNHNAAQMP----PRVP-ITPSEVLKAYGERLTDWERNEVRKYPEVWFVGLEANKVQARANLPNNCGFDDENGSYNKQMHDHIAYRYEILEVIGKGSFGQVIRALDHRTGNQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGAPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMEVLGPPPPDLLLHATRKRLFFDSKGCPRTVTNSKGRKRRPGSRALSAAVRTDDPAFLHFIHRCLEWDPKRRITPTEATRHEFVTGCALGTSTTGVLALPRLAPPRPAGAALLHSQSAGDVAAMLGRA 460          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|827553273|ref|XP_012548335.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 2-like [Bombyx mori])

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 414/456 (90.79%), Postives = 430/456 (94.30%), Query Frame = 0
Query:    6 LQIEAGAGEGPGPPANNNAEGA-AGAQRDDNHNAPNPPTPPTPRVTQLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            LQIEA AGEGPGPP NNN++GA A   RDDNHN P  P P T R   LTP+EALKLY ERL+EWER EIRKYP++WF+GLE+NKVQARSNLPNNCGFDDE G+Y KQIHDHIAYRYEILE+IGKGSFGQVIRALDHRT  QVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYT ARVYTYIQSRFYRSPEVILGLQYG  IDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLL+HATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLA+AVRT++PAFLHFLHRCLEWDPKRRITPTEA+RHEFVTGC LG+ PSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA
Sbjct:   13 LQIEAAAGEGPGPPVNNNSDGAVASTPRDDNHN-PGQPPPATARAAPLTPAEALKLYGERLTEWERNEIRKYPQIWFLGLESNKVQARSNLPNNCGFDDETGAYYKQIHDHIAYRYEILEIIGKGSFGQVIRALDHRTGEQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTDARVYTYIQSRFYRSPEVILGLQYGPAIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLIHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLASAVRTEEPAFLHFLHRCLEWDPKRRITPTEASRHEFVTGCPLGSTPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 467          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|913323364|ref|XP_013192949.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 2 [Amyelois transitella])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 385/405 (95.06%), Postives = 399/405 (98.52%), Query Frame = 0
Query:   56 EALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            EALKLY +R++EWER EIRKYPE+WF+GLEANK+QA+SNLPNNCGFDD+NGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRT  QVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFA+SLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGT IDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLL+HATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGC LG+AP+G+LALPRLAPPRPTRG+LLHSQSAGDVAAMLGRA
Sbjct:   31 EALKLYGDRITEWERNEIRKYPEIWFLGLEANKIQAKSNLPNNCGFDDDNGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTGTQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFANSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTAIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLIHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCPLGSAPTGILALPRLAPPRPTRGSLLHSQSAGDVAAMLGRA 435          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|943956012|ref|XP_014360914.1| (PREDICTED: LOW QUALITY PROTEIN: dual specificity tyrosine-phosphorylation-regulated kinase 2-like [Papilio machaon])

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 391/458 (85.37%), Postives = 410/458 (89.52%), Query Frame = 0
Query:    6 LQIEAGAGEGPGPPANNNAEGAAGAQRDDNHNAPNPPTPPTPRVTQLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRL---FFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            LQIE GAGEGPGPP NNN+EGAA + RDDNHNA  PP    PRV  LTPSE LK Y ERL+EWER E+RKYPEVWF+GLEANKVQAR+NLPNNCGFDDENGSYNKQ+HDHIAYRYEILEVIGKGSFGQVIRALDHRT  QVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYG PIDMWSMGCILAELHTGYPLFPGE  +  ++ + ++L      L L    +     F DSKG PR+VTNSKGRKRRPGSR L+ AVRTDDPAFLHF+HRCLEWDPKRRITPTEATRHEFVTGCALGT+ +GVLALPRLAPPRP R ALLHSQSAGDVAAMLGRA
Sbjct:   13 LQIE-GAGEGPGPP-NNNSEGAAASPRDDNHNASQPP----PRVP-LTPSEVLKAYGERLTEWERNEVRKYPEVWFVGLEANKVQARANLPNNCGFDDENGSYNKQMHDHIAYRYEILEVIGKGSFGQVIRALDHRTGDQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGGPIDMWSMGCILAELHTGYPLFPGE-RSSXVSFVEQIL------LXLSIVDRTALCPFIDSKGCPRTVTNSKGRKRRPGSRALSAAVRTDDPAFLHFIHRCLEWDPKRRITPTEATRHEFVTGCALGTSTTGVLALPRLAPPRPARAALLHSQSAGDVAAMLGRA 456          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|930656184|gb|KPI98510.1| (Dual specificity tyrosine-phosphorylation-regulated kinase 2 [Papilio xuthus])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 382/432 (88.43%), Postives = 394/432 (91.20%), Query Frame = 0
Query:   55 SEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLE--------------------------WDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            S+ LK Y ERL+EWER E+RKYPEVWF+GLEANKVQAR+NLPNNCGFDDENGSYNKQ+HDHIAYRYEILEVIGKGSFGQVIRALDHRT HQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYG PIDMWSMGCILAELHTGYPLFPGENEAEQLACIME+LGPPPPDLLLHATRKRLFFDSKG PR+VTNSKGRKRRPGSR L+ AVRTDDPAFLHF+HRCLE                          WDPKRRITPTEATRHEFVTGCALGT+ +GVLALPRLAPPRP R ALLHSQSAGDVAAMLGRA
Sbjct:   95 SKVLKAYGERLTEWERNEVRKYPEVWFVGLEANKVQARANLPNNCGFDDENGSYNKQMHDHIAYRYEILEVIGKGSFGQVIRALDHRTGHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGAPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMEVLGPPPPDLLLHATRKRLFFDSKGCPRTVTNSKGRKRRPGSRALSAAVRTDDPAFLHFIHRCLEANSPSVRTSCPIGYHLQYTAFGQSLKWDPKRRITPTEATRHEFVTGCALGTSTTGVLALPRLAPPRPARAALLHSQSAGDVAAMLGRA 526          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|357604143|gb|EHJ64059.1| (putative Dual specificity tyrosine-phosphorylation-regulated kinase [Danaus plexippus])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 381/409 (93.15%), Postives = 392/409 (95.84%), Query Frame = 0
Query:   52 LTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSAGDVAAMLGRA 460
            +   E LKLY +RLSEWERTE+RKYPE+WF+GLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALD+RT +QVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFA+SLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTH RVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAEL TGYPLFPGENE EQLACIMELLGPPPPDLLLHATRKRLFFDSKG PRSVTNSKGRKRRPGSR LA AVR+DDPAFLHFLHRCLEWDPKRRITPTEA+RHEFV GCALG+ PSGVLALPRL PPRP R ALLHSQSAGDVAAMLGRA
Sbjct:    2 ILEEEVLKLYGDRLSEWERTEVRKYPEIWFLGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDYRTGNQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFANSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHERVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELRTGYPLFPGENETEQLACIMELLGPPPPDLLLHATRKRLFFDSKGCPRSVTNSKGRKRRPGSRALAAAVRSDDPAFLHFLHRCLEWDPKRRITPTEASRHEFVMGCALGSTPSGVLALPRLPPPRPARTALLHSQSAGDVAAMLGRA 410          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|768408873|ref|XP_011549692.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 2 [Plutella xylostella])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 364/413 (88.14%), Postives = 386/413 (93.46%), Query Frame = 0
Query:   52 LTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPP----RPTRGALLHSQSAGDVAAMLGRA 460
            +TP+EALKLY +RLSEWER EIRKYPEVWF+GL+++KVQAR+ LPNN GFDD+NGSYNK +HDH+AYRYEILEVIGKGSFGQVIRALDHRT   VAIKIIRNKKRFHHQALVEVRVLDHLRLKD++Q+HNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGT IDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLL ATRKRLFFDSKGSPRSVTNSKGRKRRP +R+LA AVR+DDPAF+HFLHRCLEWDPKRRITPTEATRHEF+TGC LG+  S V ++ R AP        RGALLHSQSAGDVAAMLGRA
Sbjct:    1 MTPTEALKLYGDRLSEWERAEIRKYPEVWFLGLDSHKVQARAALPNNAGFDDDNGSYNKSMHDHVAYRYEILEVIGKGSFGQVIRALDHRTGTCVAIKIIRNKKRFHHQALVEVRVLDHLRLKDREQAHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTAIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLQATRKRLFFDSKGSPRSVTNSKGRKRRPSTRSLAAAVRSDDPAFMHFLHRCLEWDPKRRITPTEATRHEFITGCPLGSTTSMVGSIARAAPAPGVRAGARGALLHSQSAGDVAAMLGRA 413          
BLAST of HiSeq38294 vs. genbank:protein
Match: gi|952513810|gb|KRT80329.1| (phosphotransferase, partial [Oryctes borbonicus])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 283/399 (70.93%), Postives = 334/399 (83.71%), Query Frame = 0
Query:   18 PPANNNAEGAAGAQRDDNHNAPNPPTPPTPRVTQLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCGFDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKIIRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTPIDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRKRLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWDPKRRITPTEATRHEFV 416
            P  NNN+        ++ +  P    P       LTPSEAL+LY  RL+E+E+TEI KYP++W++GL+A K+        N GFDD++GSYNK +HDHI YRYEILEVIGKGSFGQVIRALDH T   VAIKIIRNKKRFHHQALVEVR+LDHLR +DK+  HNVIHM DYFYFRNHLCISFELMS+NLYELIKKNNYQGFSL+LIRRFA+SLL+CLRLL+ ENIIHCDLKPEN+LLK RGSSSIKVIDFGSSCY++ RVYTYIQSRFYRSPEVILGL YGTPIDMWS+GCILAEL+TGYPLFPGENE EQLAC+ME+LGPPP +++  ATR+RLFFDS+G+PR +TN+KGRKR+PGS+ LA A+R +D  F+ F+ RCLEW+PK+R+TP EA RHE++
Sbjct:   97 PSINNNSRSQVNLSNNNKNEEPVTILP-------LTPSEALRLYGNRLTEYEKTEIEKYPKIWYLGLDACKIHGEHGGSQNGGFDDDSGSYNKVLHDHIGYRYEILEVIGKGSFGQVIRALDHMTNQHVAIKIIRNKKRFHHQALVEVRILDHLRKRDKEGVHNVIHMQDYFYFRNHLCISFELMSLNLYELIKKNNYQGFSLNLIRRFANSLLKCLRLLQRENIIHCDLKPENVLLKQRGSSSIKVIDFGSSCYSNQRVYTYIQSRFYRSPEVILGLTYGTPIDMWSLGCILAELYTGYPLFPGENEVEQLACLMEVLGPPPDEIIAAATRRRLFFDSRGNPRCITNTKGRKRKPGSKNLAIALRCNDHLFIDFISRCLEWNPKKRMTPEEALRHEWI 488          
The following BLAST results are available for this feature:
BLAST of HiSeq38294 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910354046|ref|XP_013181068.1|0.000e+091.74PREDICTED: dual specificity tyrosine-phosphorylati... [more]
gi|910354044|ref|XP_013181067.1|0.000e+091.87PREDICTED: dual specificity tyrosine-phosphorylati... [more]
gi|909582202|ref|XP_013147120.1|0.000e+090.99PREDICTED: dual specificity tyrosine-phosphorylati... [more]
gi|827553273|ref|XP_012548335.1|0.000e+090.79PREDICTED: dual specificity tyrosine-phosphorylati... [more]
gi|913323364|ref|XP_013192949.1|0.000e+095.06PREDICTED: dual specificity tyrosine-phosphorylati... [more]
gi|943956012|ref|XP_014360914.1|0.000e+085.37PREDICTED: LOW QUALITY PROTEIN: dual specificity t... [more]
gi|930656184|gb|KPI98510.1|0.000e+088.43Dual specificity tyrosine-phosphorylation-regulate... [more]
gi|357604143|gb|EHJ64059.1|0.000e+093.15putative Dual specificity tyrosine-phosphorylation... [more]
gi|768408873|ref|XP_011549692.1|0.000e+088.14PREDICTED: dual specificity tyrosine-phosphorylati... [more]
gi|952513810|gb|KRT80329.1|0.000e+070.93phosphotransferase, partial [Oryctes borbonicus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0004674 protein serine/threonine kinase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002290Serine/threonine/dual specificity protein kinase, catalytic domainSMARTSM00220S_TKccoord: 120..416
e-value: 1.6E-85
score: 300.1
NoneNo IPR availableGENE3D1.10.510.10coord: 197..417
e-value: 5.7E-64
score: 215.4
NoneNo IPR availableGENE3D3.30.200.20coord: 107..196
e-value: 2.9E-27
score: 94.1
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 50..418
NoneNo IPR availablePANTHERPTHR24058:SF22DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 4coord: 50..418
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 120..416
e-value: 4.4E-57
score: 193.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 120..416
score: 38.76
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 126..149
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 242..254
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 110..425

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq38294HiSeq38294Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq38294_p ID=HiSeq38294_p|Name=HiSeq38294|organism=Ostrinia scapulalis|type=polypeptide|length=460bp
MILYDLQIEAGAGEGPGPPANNNAEGAAGAQRDDNHNAPNPPTPPTPRVT
QLTPSEALKLYAERLSEWERTEIRKYPEVWFMGLEANKVQARSNLPNNCG
FDDENGSYNKQIHDHIAYRYEILEVIGKGSFGQVIRALDHRTMHQVAIKI
IRNKKRFHHQALVEVRVLDHLRLKDKDQSHNVIHMLDYFYFRNHLCISFE
LMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPE
NILLKARGSSSIKVIDFGSSCYTHARVYTYIQSRFYRSPEVILGLQYGTP
IDMWSMGCILAELHTGYPLFPGENEAEQLACIMELLGPPPPDLLLHATRK
RLFFDSKGSPRSVTNSKGRKRRPGSRTLATAVRTDDPAFLHFLHRCLEWD
PKRRITPTEATRHEFVTGCALGTAPSGVLALPRLAPPRPTRGALLHSQSA
GDVAAMLGRA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
Vocabulary: INTERPRO
TermDefinition
IPR011009Kinase-like_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR002290Ser/Thr_dual-sp_kinase