HiSeq38295_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq38295
Unique NameHiSeq38295_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length739
Homology
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|909556681|ref|XP_013133279.1| (PREDICTED: CSC1-like protein 2 [Papilio polytes])

HSP 1 Score: 1275.77 bits (3300), Expect = 0.000e+0
Identity = 614/735 (83.54%), Postives = 681/735 (92.65%), Query Frame = 0
Query:   11 FAPTNTSNGTDEGCMIINSTSKILFFG-YNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALV-RRRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTG-NLQGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLD-SPMSTPTTPDYGASSPTTIQSYSPDPINI 739
            F  +N+SN  DEGCM++N++  ++  G YNGIPQTLILN+ISWSCLI LF++LRRTAWNYGRMALVQR+++RWTNLFYRG DGD+LV RRRS DE ++IDEGFF WLPAVFR+TREQVLAKCGPDAVHYLSFQRHAITLMFI+TI+SIGIILPINF G NLQ D   FS+TTLSNLNGRS WLW HTLISI FLP+SVLIMRRCTGRKPVPTS+TGT+MITNI+R DRNE+TIRAYF HN PHIQIVDLRLAYNINKLNEVQEKK+MVTEAL+Y+D Y+KKTGKRITVR  LCGP VDALE+YTNEEKRLKDEAKRC+AMVLNDPLGIAFLTLPSYQLAEHVINNF+LHRGWVL+HATNP+DI+WENLSVQP VWY+KAI VN+ LF+VLFFLTTPAIIVNLFNTL VK D+  + SS++FEFLPTLLLWTMAAVMPAIV F+DKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFV WTLHHENDTMRWDCVFL DKGAFF+NYVITSGFIGTALELIRFPELFLYVWYLL SKSKAEKSYVKKAILYEFPFGVHYAWSLAI SI++VYSLACPLI+PFGL+Y++LKHIGDKHNLYFAYGPSDMSGVGGGRIH+ AVR++R+SVLLLL+NMAAWAGLR+GFEARTIIL+MASIVAFGTFLLLSPFPSCTPPAPLQ E++VRFPEYVAP L KP+D +P+STP+TPDYG +SP +   Y+PDPINI
Sbjct:   11 FTSSNSSNAADEGCMLVNTSQNVIITGAYNGIPQTLILNVISWSCLIALFTILRRTAWNYGRMALVQRSRNRWTNLFYRGADGDSLVERRRSQDEASNIDEGFFAWLPAVFRVTREQVLAKCGPDAVHYLSFQRHAITLMFIVTIVSIGIILPINFQGTNLQVDANTFSRTTLSNLNGRSLWLWAHTLISICFLPISVLIMRRCTGRKPVPTSMTGTVMITNISRGDRNEATIRAYFTHNIPHIQIVDLRLAYNINKLNEVQEKKEMVTEALLYTDTYYKKTGKRITVRKELCGPDVDALEYYTNEEKRLKDEAKRCQAMVLNDPLGIAFLTLPSYQLAEHVINNFNLHRGWVLTHATNPSDIVWENLSVQPSVWYVKAIIVNVALFIVLFFLTTPAIIVNLFNTLVVKPDSLNRISSIIFEFLPTLLLWTMAAVMPAIVGFTDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVAWTLHHENDTMRWDCVFLPDKGAFFVNYVITSGFIGTALELIRFPELFLYVWYLLQSKSKAEKSYVKKAILYEFPFGVHYAWSLAIISITIVYSLACPLISPFGLVYLLLKHIGDKHNLYFAYGPSDMSGVGGGRIHAAAVRMVRVSVLLLLVNMAAWAGLRSGFEARTIILIMASIVAFGTFLLLSPFPSCTPPAPLQAETSVRFPEYVAPVLLKPVDTTPVSTPSTPDYGTNSPVSNPIYNPDPINI 745          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|910345831|ref|XP_013176796.1| (PREDICTED: CSC1-like protein 2 [Papilio xuthus])

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 614/725 (84.69%), Postives = 677/725 (93.38%), Query Frame = 0
Query:   21 DEGCMIINSTSKILFFG-YNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALV-RRRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTG-NLQGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLDS-PMSTPTTPDYGASSPTTIQSYSPDPINI 739
            DEGCM++N++  ++  G YNGIPQTLILN+ISWSCLI LF++LRRTAWNYGRMALVQR+++RWTNLFYRG DGD+LV RRRS DE ++IDEGFF WLPAVFR+TREQVLAKCGPDAVHYLSFQRHAITLMFI+TI+SIGIILPINF G NLQ D   FS+TTLSNLNGRS WLW HTLISI FLP+SVLIMRRCTGRKPVPTS+TGT+MITNI+R DRNE+TIRAYF HNFPHIQIVDLRLAYNINKLNEVQEKK+MVTEAL+Y+D Y+KKTGKRITVR  LCGP VDALE+YTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNF+LHRGWVL+HATNP+DI+WENLSVQP VWY+KAI VN+ LF+VLFFLTTPAIIVNLFNTL VK D+  + SS++FEFLPTLLLWTMAAVMPAIV F+DKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFV WTLHHENDTMRWDCVFL DKGAFF+NYVITSGFIGTALELIRFPELFLYVWYLL SKSKAEKSYVKKAILYEFPFGVHYAWSLAI SI++VYSLACPLI+PFGL+Y++LKHIGDKHNLYFAYGPSDMSGVGGGRIH+ AVR++R+SVLLLL+NMAAWAGLR+GFEARTIIL+MASIVAFGTFLLLSPFPSCTPPAPLQ E++VRF EYVAP L KP+DS P+STP+TPDYGA+SP T  +Y+PDPINI
Sbjct:   21 DEGCMLVNTSQNVIITGAYNGIPQTLILNVISWSCLIALFTILRRTAWNYGRMALVQRSRNRWTNLFYRGADGDSLVERRRSQDEASTIDEGFFAWLPAVFRVTREQVLAKCGPDAVHYLSFQRHAITLMFIVTIVSIGIILPINFQGTNLQVDANTFSRTTLSNLNGRSLWLWAHTLISICFLPISVLIMRRCTGRKPVPTSMTGTVMITNISRGDRNEATIRAYFTHNFPHIQIVDLRLAYNINKLNEVQEKKEMVTEALIYTDTYYKKTGKRITVRKELCGPEVDALEYYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFNLHRGWVLTHATNPSDIVWENLSVQPSVWYVKAIIVNVALFIVLFFLTTPAIIVNLFNTLVVKPDSLNRISSIIFEFLPTLLLWTMAAVMPAIVGFTDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVAWTLHHENDTMRWDCVFLPDKGAFFVNYVITSGFIGTALELIRFPELFLYVWYLLQSKSKAEKSYVKKAILYEFPFGVHYAWSLAIISITIVYSLACPLISPFGLVYLLLKHIGDKHNLYFAYGPSDMSGVGGGRIHAAAVRMVRVSVLLLLVNMAAWAGLRSGFEARTIILIMASIVAFGTFLLLSPFPSCTPPAPLQAETSVRFQEYVAPVLLKPVDSTPVSTPSTPDYGANSPVTNPTYNPDPINI 745          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|930652819|gb|KPI95158.1| (Transmembrane protein 63A [Papilio xuthus])

HSP 1 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 614/725 (84.69%), Postives = 677/725 (93.38%), Query Frame = 0
Query:   21 DEGCMIINSTSKILFFG-YNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALV-RRRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTG-NLQGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLDS-PMSTPTTPDYGASSPTTIQSYSPDPINI 739
            DEGCM++N++  ++  G YNGIPQTLILN+ISWSCLI LF++LRRTAWNYGRMALVQR+++RWTNLFYRG DGD+LV RRRS DE ++IDEGFF WLPAVFR+TREQVLAKCGPDAVHYLSFQRHAITLMFI+TI+SIGIILPINF G NLQ D   FS+TTLSNLNGRS WLW HTLISI FLP+SVLIMRRCTGRKPVPTS+TGT+MITNI+R DRNE+TIRAYF HNFPHIQIVDLRLAYNINKLNEVQEKK+MVTEAL+Y+D Y+KKTGKRITVR  LCGP VDALE+YTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNF+LHRGWVL+HATNP+DI+WENLSVQP VWY+KAI VN+ LF+VLFFLTTPAIIVNLFNTL VK D+  + SS++FEFLPTLLLWTMAAVMPAIV F+DKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFV WTLHHENDTMRWDCVFL DKGAFF+NYVITSGFIGTALELIRFPELFLYVWYLL SKSKAEKSYVKKAILYEFPFGVHYAWSLAI SI++VYSLACPLI+PFGL+Y++LKHIGDKHNLYFAYGPSDMSGVGGGRIH+ AVR++R+SVLLLL+NMAAWAGLR+GFEARTIIL+MASIVAFGTFLLLSPFPSCTPPAPLQ E++VRF EYVAP L KP+DS P+STP+TPDYGA+SP T  +Y+PDPINI
Sbjct:   21 DEGCMLVNTSQNVIITGAYNGIPQTLILNVISWSCLIALFTILRRTAWNYGRMALVQRSRNRWTNLFYRGADGDSLVERRRSQDEASTIDEGFFAWLPAVFRVTREQVLAKCGPDAVHYLSFQRHAITLMFIVTIVSIGIILPINFQGTNLQVDANTFSRTTLSNLNGRSLWLWAHTLISIWFLPISVLIMRRCTGRKPVPTSMTGTVMITNISRGDRNEATIRAYFTHNFPHIQIVDLRLAYNINKLNEVQEKKEMVTEALIYTDTYYKKTGKRITVRKELCGPEVDALEYYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFNLHRGWVLTHATNPSDIVWENLSVQPSVWYVKAIIVNVALFIVLFFLTTPAIIVNLFNTLVVKPDSLNRISSIIFEFLPTLLLWTMAAVMPAIVGFTDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVAWTLHHENDTMRWDCVFLPDKGAFFVNYVITSGFIGTALELIRFPELFLYVWYLLQSKSKAEKSYVKKAILYEFPFGVHYAWSLAIISITIVYSLACPLISPFGLVYLLLKHIGDKHNLYFAYGPSDMSGVGGGRIHAAAVRMVRVSVLLLLVNMAAWAGLRSGFEARTIILIMASIVAFGTFLLLSPFPSCTPPAPLQAETSVRFQEYVAPVLLKPVDSTPVSTPSTPDYGANSPVTNPTYNPDPINI 745          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|943965632|ref|XP_014364944.1| (PREDICTED: CSC1-like protein 2 [Papilio machaon] >gi|930669295|gb|KPJ10198.1| Transmembrane protein 63A [Papilio machaon])

HSP 1 Score: 1271.91 bits (3290), Expect = 0.000e+0
Identity = 611/735 (83.13%), Postives = 681/735 (92.65%), Query Frame = 0
Query:   11 FAPTNTSNGTDEGCMIINSTSKILFFG-YNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALV-RRRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTG-NLQGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLDS-PMSTPTTPDYGASSPTTIQSYSPDPINI 739
            F+ +N+S   DEGCM++N++  ++  G YNGIPQTLILN+ISW+CLI LF++LRRTAWNYGRMALVQR+++RWTNLFYRG DGD+LV RRRS DE ++IDEGFF WLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFI+TI+SIGIILPINF G NLQ D   FS+TTL+NLNGRS WLW HTLISI FLP+SVLIMRRCTGRKPVPTS+TGT+MITNI++ DRNE+TIRAYF HNFPHIQIVDLRLAYNINKLNEVQEKK+MVTEAL+Y+D Y+KKTGKRITVR  LCGP VDALE+YTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNF+LHRGWVL+HATNP+DI+WENLSVQP +WY+KAI VN  LF+VLFFLTTPAIIVNLFNTL VK D+  + SS++FEFLPTLLLWTMAAVMPAIV F+DKFLSHWTKS+QNYSIMTKTVSFLLLMTLILPSLGLASAEAFV WTLHHENDTMRWDCVFL DKGAFF+NYVITSGFIGTALELIRFPELFLYVWYLL SKSKAEKSYVKKAILYEFPFGVHYAWSLAI SI++VYSLACPLI+PFGL+Y++LKHIGDKHNLYFAYGPSDMSGVGGGRIH+ AVR++R+SVLLLL+NMAAWAGLR+GFEARTIIL+MASIVAFGTFLLLSPFPSCTPPAPLQ E++VRF EYVAP L KP+DS P+STP+TPDYGA+SP    +Y+P+PINI
Sbjct:   11 FSSSNSSTPADEGCMLVNTSQNVIITGAYNGIPQTLILNVISWTCLIALFTILRRTAWNYGRMALVQRSRNRWTNLFYRGADGDSLVERRRSQDEASTIDEGFFAWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIVTIVSIGIILPINFQGTNLQVDANTFSRTTLTNLNGRSLWLWAHTLISICFLPISVLIMRRCTGRKPVPTSMTGTVMITNISKGDRNEATIRAYFTHNFPHIQIVDLRLAYNINKLNEVQEKKEMVTEALIYTDTYYKKTGKRITVRKKLCGPEVDALEYYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFNLHRGWVLTHATNPSDIVWENLSVQPSIWYVKAIIVNFSLFIVLFFLTTPAIIVNLFNTLVVKPDSLNRISSIIFEFLPTLLLWTMAAVMPAIVGFTDKFLSHWTKSRQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVAWTLHHENDTMRWDCVFLPDKGAFFVNYVITSGFIGTALELIRFPELFLYVWYLLQSKSKAEKSYVKKAILYEFPFGVHYAWSLAIISITIVYSLACPLISPFGLVYLLLKHIGDKHNLYFAYGPSDMSGVGGGRIHAAAVRMVRVSVLLLLVNMAAWAGLRSGFEARTIILIMASIVAFGTFLLLSPFPSCTPPAPLQAETSVRFQEYVAPVLLKPVDSTPVSTPSTPDYGANSPVINPTYNPNPINI 745          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|914574663|gb|KOB76924.1| (Transmembrane protein 63A [Operophtera brumata])

HSP 1 Score: 1267.68 bits (3279), Expect = 0.000e+0
Identity = 605/735 (82.31%), Postives = 679/735 (92.38%), Query Frame = 0
Query:   12 APTNTSNGTDEGCMIINSTSKILFFG-YNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALV-RRRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTGNL-QGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGF-EARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLDSPMS-TPTTPDYGASSPTTIQSYSPDPINI 739
            A +N SNGTD+GCM++NS+  ++  G YNGIPQTLILNLISWS LI+LFSVLRRTAWNYGRMALVQR+KSRWTNLFYRGGDGDALV RRRS DE+  IDEGFFTWLPAVFR+TREQVLAKCGPDAVHYLSFQRH+ITLMFI+T++SIGIILP+NF G+L + D   FS+TTLSN+ G S WLWVHTLISIAFLP+S+LIMRRCTGRKPVP S+TGT+MITNI++ADRNESTIRAYFAHNFPHI IVDLRLA+N+NKL EVQEKK+MV+EAL+Y+D Y+KKTGKRITV+    GP VDAL+FYT+EEKRLKDEAKRCRA+V+NDPLGIAFLTLPSYQLAEHV N+FSLHRGWVLSHATNP+DIIWENLSVQPGVWYI+A  +N+ LF++LFFLTTPAI+VNLFNTL VK ++  K S+V+FEFLPTLLLWTMAA+MPAIV+FSDKFL+HWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASA++FVRWT HHENDTMRW+CVFL DKGAFF+NYVITSGFIGT+LELIRFPELFLYVWYLL SKSKAEKSYVK+AILYEFPFGVHYAWS+AIFSI+MVYSLACPLIAPFGLIYM+LKH+GDKHNLYFAYGP DMSGVGGGRIH++AVRLIR+SVLLLL+NMAAWA LRAG  EARTIIL+MASIVAFGT +LLSPFPSCTPPAPLQEE ++R+ EYVAP L KP+DSP+S TPTTPDYGASSP T  SYSP PINI
Sbjct:    6 AASNASNGTDDGCMLVNSSQSVIITGAYNGIPQTLILNLISWSFLIMLFSVLRRTAWNYGRMALVQRSKSRWTNLFYRGGDGDALVERRRSNDESLQIDEGFFTWLPAVFRVTREQVLAKCGPDAVHYLSFQRHSITLMFIVTLVSIGIILPVNFQGDLLKVDASTFSRTTLSNVKGSSLWLWVHTLISIAFLPVSILIMRRCTGRKPVPKSMTGTVMITNISKADRNESTIRAYFAHNFPHIPIVDLRLAFNVNKLIEVQEKKEMVSEALIYTDTYYKKTGKRITVKPTWFGPEVDALDFYTSEEKRLKDEAKRCRAIVINDPLGIAFLTLPSYQLAEHVTNHFSLHRGWVLSHATNPSDIIWENLSVQPGVWYIRAFIINVILFVILFFLTTPAIVVNLFNTLIVKPESMSKISTVIFEFLPTLLLWTMAAIMPAIVSFSDKFLAHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASADSFVRWTFHHENDTMRWECVFLPDKGAFFVNYVITSGFIGTSLELIRFPELFLYVWYLLQSKSKAEKSYVKRAILYEFPFGVHYAWSIAIFSITMVYSLACPLIAPFGLIYMMLKHVGDKHNLYFAYGPCDMSGVGGGRIHASAVRLIRVSVLLLLVNMAAWAALRAGIPEARTIILIMASIVAFGTIMLLSPFPSCTPPAPLQEEPSMRYTEYVAPVLNKPIDSPLSTTPTTPDYGASSPVTTHSYSPGPINI 740          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|913312591|ref|XP_013187030.1| (PREDICTED: CSC1-like protein 2 [Amyelois transitella])

HSP 1 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 604/743 (81.29%), Postives = 674/743 (90.71%), Query Frame = 0
Query:    4 SSFTDDIFAPTNTSNGT-DEGCMIINSTSKILFFG-YNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALVR-RRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTGNLQGD--MGFSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLD-TQKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLD-SPMSTPTTPDYGASSPTTIQSYSPDPINI 739
            S F D   +    +N + DEGCM+ N++  ++    YNGIPQTLILNLISW+ LILLF VLRRTAWNYGRMALVQR+KSRWTNLFYR GD + LV   RSA+E  +IDEGFFTWLPAVFRL+REQ+L KCGPDAVHYLSFQRHAITLMFIIT+ISIG+ILPINF+G++  D     ++TTLSNLNGRSYWLWVHTLISI+F+P+S+LIMRRCTGRKPVPTS+TGTIMITNI++ADRNESTIRAYFAHNFPHIQIVDLRLA+NINKLNEV EKK+MV+EALVY+D YF+KTGKRI VR   CGP VDALEFYTNE+KRLKDEAKR RA+VLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVL+HATNPADIIWENL+VQPGVWYIKA FVN FLF+VLFFLTTPAI+VNLFNTL  K +   K S+V+F+FLPTLLLWTMAAVMPAIVAFSDKFLSHWTKS QNYSIMTKTVSFLLLMTLILPSLGLASA++FVRWT HHENDTMRWDCVFL DKGAFF+NYVITS FIGT+LELIRFPELFLYVWYLL SKSKAEKSYVK+AILYEFPFGVHYAWS+AIFSI+MVYSLACPLIAPFGLIY++LKH+ DKHNLYFAYGP DMSGVGGGRIH+TAVRLIR+SV+LLLI+MAAWAGLR+GFEARTIIL+MASIVAF TFLLLSPFPSCTPPAPLQEE +++FP YVAP L+KP+D +P +TPTTPDYGASSP   Q+Y+P+PINI
Sbjct:    6 SFFADTTLSSLALANSSVDEGCMLWNTSQSVIITPVYNGIPQTLILNLISWAFLILLFCVLRRTAWNYGRMALVQRSKSRWTNLFYRSGDNEELVNGTRSAEEPPNIDEGFFTWLPAVFRLSREQILVKCGPDAVHYLSFQRHAITLMFIITVISIGVILPINFSGDVWRDDNTTLARTTLSNLNGRSYWLWVHTLISISFIPISILIMRRCTGRKPVPTSITGTIMITNISKADRNESTIRAYFAHNFPHIQIVDLRLAFNINKLNEVLEKKEMVSEALVYTDTYFRKTGKRIMVRPKWCGPEVDALEFYTNEQKRLKDEAKRIRAIVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLTHATNPADIIWENLNVQPGVWYIKAFFVNFFLFIVLFFLTTPAIVVNLFNTLVAKPEHMTKVSTVIFDFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSHQNYSIMTKTVSFLLLMTLILPSLGLASADSFVRWTWHHENDTMRWDCVFLPDKGAFFVNYVITSAFIGTSLELIRFPELFLYVWYLLQSKSKAEKSYVKRAILYEFPFGVHYAWSIAIFSITMVYSLACPLIAPFGLIYLLLKHVADKHNLYFAYGPCDMSGVGGGRIHATAVRLIRLSVVLLLISMAAWAGLRSGFEARTIILIMASIVAFATFLLLSPFPSCTPPAPLQEEPSIQFPAYVAPVLSKPIDSTPSTTPTTPDYGASSPVITQAYNPEPINI 748          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|357609887|gb|EHJ66736.1| (hypothetical protein KGM_03209 [Danaus plexippus])

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 407/469 (86.78%), Postives = 437/469 (93.18%), Query Frame = 0
Query:  273 MVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLDS-PMSTPTTPDYGASSPTTIQSYSPDPINI 739
            MVTEAL+Y+D Y++KTGKRITV+  LCGP VDALEFYT EEKRLKDEAKRCRA+VLNDPLGIAFLTLPSYQLAEHVIN+FSLHRGWVL HATNP+DIIWENLSVQPGVWY+KAI VN+ LF+VLFFLTTPA +VNLFNTL  K +T  K SS++FEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIM KT S+LLLMTLILPSLGLASAEAF+ WTLHHENDT+RWDCVFL DKGAFF+NYVITSGFIGTALELIRFPELFLYVWYLL SKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSI+MVYSLACPLIAPFGLIY VLKHIGDKHNLYFAYGP DMSGVGGGRIH+TAVRLIRISVLLLLINMAAWAGLRAGFEARTIIL+MAS+VAFGTFLLLSPFPSCTPPAPLQ E+T+RFPEYVAP LTKP+D+ P S  +TPDYGASSP    SY+P+PINI
Sbjct:    1 MVTEALIYTDTYYRKTGKRITVKPTLCGPEVDALEFYTQEEKRLKDEAKRCRALVLNDPLGIAFLTLPSYQLAEHVINHFSLHRGWVLQHATNPSDIIWENLSVQPGVWYVKAIVVNVCLFIVLFFLTTPAFVVNLFNTLVAKPETLSKISSLIFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMAKTASYLLLMTLILPSLGLASAEAFLAWTLHHENDTLRWDCVFLPDKGAFFVNYVITSGFIGTALELIRFPELFLYVWYLLQSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSITMVYSLACPLIAPFGLIYFVLKHIGDKHNLYFAYGPCDMSGVGGGRIHATAVRLIRISVLLLLINMAAWAGLRAGFEARTIILIMASVVAFGTFLLLSPFPSCTPPAPLQSETTLRFPEYVAPVLTKPIDTPPTSASSTPDYGASSPVVNLSYNPEPINI 469          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|827541262|ref|XP_012543914.1| (PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein 2 [Bombyx mori])

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 387/469 (82.52%), Postives = 428/469 (91.26%), Query Frame = 0
Query:  273 MVTEALVYSDQYFKKTGKRITVRTGLCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT-QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPLD-SPMSTPTTPDYGASSPTTIQSYSPDPINI 739
            MVTEAL+Y+D YFKKTGKRI V+  LCGP +DALEFYTNEEKRLKDEAKR RAMVLNDPLG+AFLTLPSYQLAEHV+N+FSLHRGWVLSHATNPADIIWE    +  + Y+KAI VN FLF+VLFFLTTPA +V+LFN   VK D+  K +S++++FLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVS+LLLMTLILPSLGLASAEAF+ WTL H+N+TMRWDCVFL DKGAFF+NYVITSGFIGT+LELIRFPELFLYVWYLL SKS+AEKSYVKKAILYEFPFGVHYAWS+AIFSI+ VYSLACPLIAPFGLIY++LKH+GDKHNLYFAYGPSDMSG+GGGRIH+TAVRLIR+SVLLLLI+MAAWAGLRAGFEARTIIL+MASIVAFGTFLLLSPFPSCTPPAPLQ ES+VRF EY+AP L KP+D  P +TPTTPDYGASSP    SY+  PINI
Sbjct:    1 MVTEALIYTDTYFKKTGKRIAVKPTLCGPEIDALEFYTNEEKRLKDEAKRSRAMVLNDPLGVAFLTLPSYQLAEHVMNHFSLHRGWVLSHATNPADIIWEXSKCEAWICYVKAIIVNFFLFVVLFFLTTPAFVVSLFNRTVVKPDSPNKITSIIYDFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSYLLLMTLILPSLGLASAEAFLMWTLQHQNNTMRWDCVFLPDKGAFFVNYVITSGFIGTSLELIRFPELFLYVWYLLQSKSRAEKSYVKKAILYEFPFGVHYAWSIAIFSITTVYSLACPLIAPFGLIYLMLKHVGDKHNLYFAYGPSDMSGMGGGRIHATAVRLIRVSVLLLLISMAAWAGLRAGFEARTIILIMASIVAFGTFLLLSPFPSCTPPAPLQAESSVRFQEYIAPVLLKPVDTPPTTTPTTPDYGASSPVNNNSYNSGPINI 469          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|1131308382|gb|JAV04552.1| (putative calcium-dependent channel, partial [Nyssomyia neivai])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 371/744 (49.87%), Postives = 485/744 (65.19%), Query Frame = 0
Query:   21 DEGCMIINSTSKILFFGYNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQRT--KSRWTNLFYRGGDGDA--------------------------LVRRRSADET-ASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTGNLQGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTG-LCGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNF--SLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDTQKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWAGLR-AGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPALTKPL-DSPMSTPTTPDYGASSPTTI 729
               C+  N T+ I    Y GIP+TLILN+I+W  L++LF+VLR+ AW+YGR+ALV  +    RWT LFY  G  +A                            +R SA  T A ID GF +W+P   RL +EQ+LA  GPDA+HYLSFQ+H I +  IIT+++I IILPINF GNL GD+  F  TT+SNL  +S  LWVH L +IAF+P+ VL MRR +GR     + T TIM  +I   DR+   IR Y    FP I+I ++ L YNI KL  V ++ +   +A +Y  Q  K  G  + V    L    +DALE+Y   E +L  E  R RA  +NDPLGIAF+T+ S + A+ ++ NF    +R W +S+A  P+DI WENLSV    WY K   VN+ LFL LFFLTTP +I+N+ NT        K S +V EFLPTLLLWT++A+MP IVA+SDK+LSHWT+S+QNYSIMTK+  +LL M LILPSLGL SA+AF+ WT H+EN T RW+C+FL DKGAFF+NYVITSGFIGT LELIRFPEL +Y+W L  +KS+AE  +++K+I+ EFPFG+HYAW + +F++S+VYSLACPLI PF +IY++LKH  D+HNLYFAY  S+M   GGG+IHSTAV + + SV+LLLI MAA A +R AG +AR ++LV+   V    F  +SP   CT   P   E+    P Y    LT+ L ++P STP+T  YG+ S  +I
Sbjct:   16 SNACLQQNKTTLITNL-YEGIPETLILNIIAWVFLMILFAVLRQQAWDYGRLALVNSSGDNRRWTQLFYAQGSDEAGGADESRQAINGGRTSINEATTSNGQASKRSSATSTGAPIDRGFLSWIPVTLRLRKEQILAHSGPDALHYLSFQQHLIVVTAIITLVAIVIILPINFHGNLIGDVNTFGHTTVSNLEPQSAVLWVHVLCAIAFVPLVVLTMRRSSGRYAGKVAPTRTIMAQDIDSRDRSIDAIRGYVRELFPDIEIEEVHLTYNITKLMSVVQEYEKAKDARLYC-QAHKTRGIDVKVYPNCLTCKAIDALEYYLERESQLAGEVARLRASAVNDPLGIAFITVSSTEAAQSILINFRPGTYREWTMSYAPAPSDIFWENLSVSTRQWYFKWSVVNIILFLFLFFLTTPVLIINILNTYIFNKGKGKVSPLVVEFLPTLLLWTLSALMPVIVAYSDKWLSHWTRSKQNYSIMTKSFGYLLFMILILPSLGLTSAQAFLDWTFHYENGTYRWECIFLPDKGAFFVNYVITSGFIGTGLELIRFPELIVYMWMLCTAKSQAETPHIRKSIVVEFPFGIHYAWMIMVFTMSVVYSLACPLIMPFAMIYLLLKHFNDRHNLYFAYRYSNMISQGGGKIHSTAVTMTKFSVVLLLIIMAALASVRSAGVDARAVVLVITLCVTLTLFAFMSPIKRCTTRPPTIVEADGPAPIYTPDVLTQRLPEAPTSTPST-SYGSGSAHSI 756          
BLAST of HiSeq38295 vs. genbank:protein
Match: gi|170050735|ref|XP_001861445.1| (transmembrane protein 63A [Culex quinquefasciatus] >gi|167872247|gb|EDS35630.1| transmembrane protein 63A [Culex quinquefasciatus])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 358/696 (51.44%), Postives = 473/696 (67.96%), Query Frame = 0
Query:   22 EGCMIINSTSKILFFGYNGIPQTLILNLISWSCLILLFSVLRRTAWNYGRMALVQR--TKSRWTNLFYRGGDGDALVRRRSADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFIITIISIGIILPINFTGNLQGDMG-FSKTTLSNLNGRSYWLWVHTLISIAFLPMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHIQIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGL-CGPHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVINNFS--LHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLTTPAIIVNLFNTLFVKLDT----QKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDKFLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHENDTMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKSKAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMVLKHIGDKHNLYFAYGPSDMSGVG-GGRIHSTAVRLIRISVLLLLINMAAWAGLRAG-FEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEYVAPAL 705
            + C ++N T K+L   Y GIP+TL+LN+ISW  LI+LF++LR+ AW+YGR+ALV       RWT LFY  G+    +   S+D + SID GFF+W+ A +RLTREQ+L   GPDAVHYLSFQRH + +M I+T ISI IILPINF+G L GD   F  TT+SNL      +WVH   +IA++PM VLIMRR +GR    T+ T T+M TN+A+ D +++ IR Y    FP + I D++LAYNIN L +  E+ + + +A +Y + +  +  + +  +        VDALE+Y +EE RL  +  R RA  LN+PLGIAF+TL S   A+HVI +F    +R W LS A  P+DI WE+LSV    WY K I VNL LFL LFFLTTP IIVN+ +T  +  +T     K S +V EFLPTLLLW+++A+MP IVA+SD +LSHWT+S+QNY IMTKT  +LL M LILPSLGL SAEAF+ WT+ + N+T RW C+FL DKGAFF+NY+IT+ FIGTALELIRFP+L  Y+W L  +KS+AE  +++K+IL  FPFG+HYAW + +F++S VYSLACPLI PF + Y++LKH  DKHNL+FA+ PS+M   G GG+IHSTAV + + SV+LLL  MAA AG+R G    R ++L+ A +V    F  +SP   CT       E+    P YVA  L
Sbjct:   14 DTCNVVNKT-KLLLNLYEGIPETLLLNVISWFFLIMLFTLLRQQAWDYGRLALVNSHGENKRWTQLFYAHGNVGGQLGAESSDASLSIDRGFFSWILATWRLTREQILTHSGPDAVHYLSFQRHLMLVMSIMTFISIVIILPINFSGELIGDRNSFGHTTISNLEPDGGVMWVHVFFAIAYVPMVVLIMRRASGRNAFKTAPTRTVMATNVAQPDCDKNAIRTYVQQLFPDVGIDDIQLAYNINSLIKAAEEYERIVDARIYCEVHRNRDREPLQAKLSCWSCESVDALEYYKDEEARLAGQVSRLRASALNEPLGIAFITLNSAHEAQHVILHFKPGTYRDWDLSFAPAPSDIFWEHLSVDTAQWYCKWITVNLVLFLFLFFLTTPVIIVNMLDTFSLTKNTTSQISKISPLVSEFLPTLLLWSLSALMPVIVAYSDTWLSHWTRSRQNYVIMTKTFGYLLFMILILPSLGLTSAEAFLEWTIKNNNETYRWQCIFLPDKGAFFVNYIITAAFIGTALELIRFPDLICYIWKLATAKSRAETPHIRKSILITFPFGIHYAWMVMVFTMSTVYSLACPLIMPFAMTYILLKHFVDKHNLFFAFAPSNMISQGSGGKIHSTAVTMTKFSVILLLSIMAALAGVREGRLNVRAVVLITALVVTLVMFTFMSPIKKCTTKPLSIVETEGAAPIYVADVL 708          
The following BLAST results are available for this feature:
BLAST of HiSeq38295 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909556681|ref|XP_013133279.1|0.000e+083.54PREDICTED: CSC1-like protein 2 [Papilio polytes][more]
gi|910345831|ref|XP_013176796.1|0.000e+084.69PREDICTED: CSC1-like protein 2 [Papilio xuthus][more]
gi|930652819|gb|KPI95158.1|0.000e+084.69Transmembrane protein 63A [Papilio xuthus][more]
gi|943965632|ref|XP_014364944.1|0.000e+083.13PREDICTED: CSC1-like protein 2 [Papilio machaon] >... [more]
gi|914574663|gb|KOB76924.1|0.000e+082.31Transmembrane protein 63A [Operophtera brumata][more]
gi|913312591|ref|XP_013187030.1|0.000e+081.29PREDICTED: CSC1-like protein 2 [Amyelois transitel... [more]
gi|357609887|gb|EHJ66736.1|0.000e+086.78hypothetical protein KGM_03209 [Danaus plexippus][more]
gi|827541262|ref|XP_012543914.1|0.000e+082.52PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein ... [more]
gi|1131308382|gb|JAV04552.1|0.000e+049.87putative calcium-dependent channel, partial [Nysso... [more]
gi|170050735|ref|XP_001861445.1|0.000e+051.44transmembrane protein 63A [Culex quinquefasciatus]... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 306..327
NoneNo IPR availablePFAMPF13967RSN1_TMcoord: 44..200
e-value: 1.2E-22
score: 80.0
NoneNo IPR availablePANTHERPTHR13018:SF39SUBFAMILY NOT NAMEDcoord: 26..685
NoneNo IPR availablePANTHERPTHR13018PROBABLE MEMBRANE PROTEIN DUF221-RELATEDcoord: 26..685
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 208..385
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 409..427
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 386..408
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 144..164
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 577..581
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 45..62
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 428..448
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 449..468
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 496..514
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 678..739
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 556..576
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 469..495
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 187..207
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..44
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 165..186
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 582..601
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 63..143
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 658..677
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 602..633
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 536..555
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 515..535
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 634..652
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 653..657
NoneNo IPR availableTMHMMTMhelixcoord: 524..546
NoneNo IPR availableTMHMMTMhelixcoord: 634..656
NoneNo IPR availableTMHMMTMhelixcoord: 469..491
NoneNo IPR availableTMHMMTMhelixcoord: 661..680
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
NoneNo IPR availableTMHMMTMhelixcoord: 567..601
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 387..406
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
NoneNo IPR availableTMHMMTMhelixcoord: 187..206
IPR003864Domain of unknown function DUF221PFAMPF02714DUF221coord: 335..647
e-value: 3.3E-65
score: 219.9

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq38295HiSeq38295Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq38295_p ID=HiSeq38295_p|Name=HiSeq38295|organism=Ostrinia scapulalis|type=polypeptide|length=739bp
MDFSSFTDDIFAPTNTSNGTDEGCMIINSTSKILFFGYNGIPQTLILNLI
SWSCLILLFSVLRRTAWNYGRMALVQRTKSRWTNLFYRGGDGDALVRRRS
ADETASIDEGFFTWLPAVFRLTREQVLAKCGPDAVHYLSFQRHAITLMFI
ITIISIGIILPINFTGNLQGDMGFSKTTLSNLNGRSYWLWVHTLISIAFL
PMSVLIMRRCTGRKPVPTSLTGTIMITNIARADRNESTIRAYFAHNFPHI
QIVDLRLAYNINKLNEVQEKKDMVTEALVYSDQYFKKTGKRITVRTGLCG
PHVDALEFYTNEEKRLKDEAKRCRAMVLNDPLGIAFLTLPSYQLAEHVIN
NFSLHRGWVLSHATNPADIIWENLSVQPGVWYIKAIFVNLFLFLVLFFLT
TPAIIVNLFNTLFVKLDTQKGSSVVFEFLPTLLLWTMAAVMPAIVAFSDK
FLSHWTKSQQNYSIMTKTVSFLLLMTLILPSLGLASAEAFVRWTLHHEND
TMRWDCVFLADKGAFFINYVITSGFIGTALELIRFPELFLYVWYLLHSKS
KAEKSYVKKAILYEFPFGVHYAWSLAIFSISMVYSLACPLIAPFGLIYMV
LKHIGDKHNLYFAYGPSDMSGVGGGRIHSTAVRLIRISVLLLLINMAAWA
GLRAGFEARTIILVMASIVAFGTFLLLSPFPSCTPPAPLQEESTVRFPEY
VAPALTKPLDSPMSTPTTPDYGASSPTTIQSYSPDPINI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR003864DUF221