HiSeq38296_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq38296
Unique NameHiSeq38296_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1217
Homology
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|913320594|ref|XP_013191419.1| (PREDICTED: uncharacterized protein LOC106135609 [Amyelois transitella])

HSP 1 Score: 1903.26 bits (4929), Expect = 0.000e+0
Identity = 993/1227 (80.93%), Postives = 1099/1227 (89.57%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSI---GSPVAQPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP-SKDVVDNGRTPDVPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKEDVSKNEINVTPKNINNEKCNKDINKTKNISPKVENSKSNVEPGNKIKIKVTPPNN-NNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDED--VIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPT-KKAGPKAKHRFATKSDK-KDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAPAHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAF-EDPKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWW DSP ++   GSPVAQP  W  N +  E DWEPQLPHWIANQP+QQRNNS DNIAQPNN QINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESN S NKSSSSSDSNNNENITV+Q   F NTP SKDVVDN +  +   GAPTPKPR RSSSVIQTPYDLQKYYEIH DEEH++LLKDK+D + N    T KN+N+E  N D   +KNISPK+ NSKSNV+  N+++IKVTPPNN +NKEN+P  SAI+ D K+VP KN+N++SPSKKYPVKKSFVSS+ETDSTK+SKVAKVKDLETSKNKSDESLE+IKLA++NEI VNNQPRVRTPISNVSYVPTER ++A+ EY+RS+SNEDNLPIT TPKF+R+RLNKSLNFEAQRLDQQILDIQ G+HSLGYIDED  VI+E+ ++   QIHKP  AILGKNIMDSLHLKPT KK GPKAK R AT+SDK KDLFRIFP KKEKPG+V++ AGGV+ GSRVPSLGLPR  EQNSWV+VGYPE+E+LIP YNERL+  D   N  AKD  N+D S +KNRRVTPPPQFQDK KTPY+TDSK ++DLTHDSKREKLK+ E+NF D+Q++LACTSTPKMLAPHE+MNG   TPKSV KN  R+NLL+  N SG+VLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMV++SSATITGNIKKVQTHGQIIVHQYS+VLRQ+E   +SEEQICLLVANINEFVLAHSITLNTKPPGETPERWD+IKKSL+LYL+KLIDIGEDVK+E+NES PEW+LV KHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAML+DS ES LHEKC+K+MK+I+DLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVT +AVKQFEEGGGIEI+SDILSD+SNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLN+IVDNITG+L+RT+CCQLLLLCTACLVNLVRELELEK ED +S  +SDIVEV T+HR+VE+LL AVKRRGP+ISVFLQEQTAS L SLSRIPRC+L LS  +A  AALVCF R+APAHAPRAAELRAQARLHCHAAEAISRL +VPEVAHQIVQLEGVPHL RLVRMQRTRPH+DVNPDQTLIHCLKALR +Y+HNPEAF E  K+VE+M+RPHLMESLMLFSAKQESYV
Sbjct:    1 MSNFQRTRSKVWWEDSPQNVRNFGSPVAQPR-WKENEKLVEPDWEPQLPHWIANQPEQQRNNSADNIAQPNNAQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNESKNKSSSSSDSNNNENITVRQV--FPNTPQSKDVVDNAKVLN-NSGAPTPKPRNRSSSVIQTPYDLQKYYEIHRDEEHMELLKDKDDKTNNI--ATAKNVNSENNNVD-KVSKNISPKIVNSKSNVDKNNRVEIKVTPPNNVSNKENTPNKSAIYSDAKEVPVKNINVISPSKKYPVKKSFVSSSETDSTKLSKVAKVKDLETSKNKSDESLEYIKLANNNEIVVNNQPRVRTPISNVSYVPTERTSIAKVEYKRSMSNEDNLPITNTPKFQRDRLNKSLNFEAQRLDQQILDIQSGHHSLGYIDEDESVIEEKFDKG--QIHKPANAILGKNIMDSLHLKPTTKKTGPKAKQRMATRSDKDKDLFRIFP-KKEKPGIVDSEAGGVLDGSRVPSLGLPRAYEQNSWVVVGYPEKEMLIPHYNERLIGGD---NTNAKD--NDDDSNMKNRRVTPPPQFQDKQKTPYETDSKNNRDLTHDSKREKLKQTEMNFVDVQINLACTSTPKMLAPHEFMNG--VTPKSVSKN-SRLNLLDKFN-SGLVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVSASSATITGNIKKVQTHGQIIVHQYSEVLRQIEEEKTSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDRIKKSLELYLRKLIDIGEDVKLEMNESNPEWNLVVKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLTDSVESDLHEKCSKIMKNITDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTGEAVKQFEEGGGIEIISDILSDQSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNSIVDNITGILTRTDCCQLLLLCTACLVNLVRELELEKPEDKSS--QSDIVEVLTRHRSVEKLLAAVKRRGPNISVFLQEQTASFLTSLSRIPRCILSLSGQSAVSAALVCFTRSAPAHAPRAAELRAQARLHCHAAEAISRLAIVPEVAHQIVQLEGVPHLIRLVRMQRTRPHVDVNPDQTLIHCLKALRIIYKHNPEAFLEYEKDVEEMIRPHLMESLMLFSAKQESYV 1206          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|910336302|ref|XP_013171661.1| (PREDICTED: uncharacterized protein LOC106120779 [Papilio xuthus])

HSP 1 Score: 1827.37 bits (4732), Expect = 0.000e+0
Identity = 938/1230 (76.26%), Postives = 1061/1230 (86.26%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVA-QPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP-SKDVVDNGRTPDVPKG-APTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKD--KEDVSKNEINVTPKNINN--EKCNKDINKTKNISPKVENSKS----NVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAP--AHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFEDPKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWWGD+PP+IGSPVA QPA WN NNRREEQDWEPQLPHWIANQP +QRNNS DNIA+PNN QINQWPLRHGSPGSHKSQDSGFSDSDSSPP  QYYP  +++NS  KS +SSDSNNNE++TVK A   QNT  S+DVVDN  + +     APTPKPRLRSSSVIQTPYDLQKYYE+H DEEH+ LLKD  KE+         P NIN   EK N      K I PK+   +S    NV P NK +                   I KDTK+ P+ NVNI+SPSKKYPVKK+FVSST +D++ I KVAKVKDLETSKNKSDESLE+IKL+ DNEIAVNNQPRVRTPISNVSYVPTER+A  + EY+RS SNE+  PI TTPKF+RNRLN+SLNFEAQRLDQQILDIQ GYHSLGYIDE++ K+ ++  TE IHKPTKA+LGKNIMDSLHLKP KK GPKAK R       KD+FRIFP+KKEKPGVV++HAGGV++GSRVPSLGLPR+AEQNSWVIVG+PE+ELLIP Y ERLVAT+SDINL++KD + E+ +++K RRVTPPPQF+DK K PYD+D+K+DKDLTHDSKREKLK + ++F D+QL+ ACTSTPKM+APHE++N  +T PKS +KN  RVNL+ + N  G+VLNNQNEILYRERSIDQTTLERLC+RKPEPVQ+WLCDL+ S ENECMTTLQSKPLG EMKA+V++SSATITGNIKKVQTHGQIIVHQYSD++RQ+E+N++ EEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIK SLQ+YLQKLIDIGEDVK+ELNES P+W+LVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAMLS++TESSLHEKC+K+MKSI++LPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVT +AVKQFEEGGGIEILSDILSDRSNPEPQMRE ITVLTQITAPWLRGHYDLTQLHLYLN+IVDNITG+LSRT+CCQLLLLCTACLVNLVRELELEK+ D+     SDIVEV T+HRT+E++LDA+KRRGP+ SVFLQEQTASL++SLSR+ RCVLPLS   A  AALV FAR +P  A APRAAELRAQAR+HCHAAEAI+RLTV+PEVA Q+VQLE VPHL RLVRMQR+RP LD NPDQTLIHCLKALR +Y+H PEAFED K+VE+M+RPHLMESLMLFSAKQESYV
Sbjct:    1 MSNFQRTRSKVWWGDTPPNIGSPVAPQPA-WNQNNRREEQDWEPQLPHWIANQP-EQRNNSADNIAEPNNAQINQWPLRHGSPGSHKSQDSGFSDSDSSPPTLQYYPPTDNSNSTVKSLNSSDSNNNEDVTVKHAIDLQNTEHSRDVVDNSISSNNISNEAPTPKPRLRSSSVIQTPYDLQKYYEVHTDEEHMDLLKDNDKENDKSEPKYPAPTNINKNYEKDNSKKIIDKAIGPKLNKVESKRVNNVNPTNKKR------------------TIQKDTKE-PSNNVNIISPSKKYPVKKTFVSSTNSDNSNIIKVAKVKDLETSKNKSDESLEYIKLSHDNEIAVNNQPRVRTPISNVSYVPTERIATVKPEYKRSNSNEE--PICTTPKFQRNRLNQSLNFEAQRLDQQILDIQGGYHSLGYIDEEIPKD-IQNQTELIHKPTKALLGKNIMDSLHLKPNKKVGPKAKQRMVKTERAKDIFRIFPTKKEKPGVVDSHAGGVLNGSRVPSLGLPRSAEQNSWVIVGHPEKELLIPHYTERLVATESDINLKSKDNE-EEINYVKTRRVTPPPQFRDKQKIPYDSDTKSDKDLTHDSKREKLKYD-IDFTDLQLNFACTSTPKMIAPHEFLNNPQT-PKSNKKNSCRVNLIGDFN-GGLVLNNQNEILYRERSIDQTTLERLCDRKPEPVQYWLCDLISSYENECMTTLQSKPLGTEMKALVSASSATITGNIKKVQTHGQIIVHQYSDIIRQIESNDTGEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKISLQMYLQKLIDIGEDVKLELNESNPQWNLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLSENTESSLHEKCSKIMKSITELPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTGEAVKQFEEGGGIEILSDILSDRSNPEPQMREGITVLTQITAPWLRGHYDLTQLHLYLNSIVDNITGILSRTDCCQLLLLCTACLVNLVRELELEKKSDE--GTNSDIVEVITRHRTIEKVLDALKRRGPNTSVFLQEQTASLISSLSRVSRCVLPLSRSAAVSAALVWFARTSPSLAPAPRAAELRAQARVHCHAAEAIARLTVIPEVAQQMVQLECVPHLIRLVRMQRSRPPLDTNPDQTLIHCLKALRTIYKHYPEAFEDKKDVEEMIRPHLMESLMLFSAKQESYV 1200          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|909549969|ref|XP_013149038.1| (PREDICTED: uncharacterized protein LOC106111465 [Papilio polytes])

HSP 1 Score: 1816.97 bits (4705), Expect = 0.000e+0
Identity = 936/1226 (76.35%), Postives = 1067/1226 (87.03%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVAQPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP-SKDVVDNGRTPD-VPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKEDVSKNEINV-TPKNINN--EKCNKDINKTKNISPKVENSKSNVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSA--AKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAP--AHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFEDPKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWWGD+PP+IGSPVA P  WN NNRREEQDWEPQLPHWIANQP +QRNNS DNIA PNN QINQWPLRHGSPGSHKSQDSGFSDSDSSPP  QYYP  +++NS  KS++SSDSNNNEN+TVKQA   QNT  S+DVVDN  + + V   APTPKPRLRSSSVIQTPYDLQKYYE+H DEEH+ LLKD +  +  E     P NINN  EK N      K I+PK+   +S        K+    P  N +        I KDTK+VP+ N+NI+SPSKKYP+KK+FVSST +D++ I KVAKVKDLETSKNKSD+SLE+IKL+ DNEIAVNNQPRVRTPISNVSYVPTER+A  + EY+RS SNE+  PI TTPKF+RNRLN+SLNFEAQRLDQQILDIQ GYHSLGYIDED  K+ ++  TE +HKPTKA+LGKNIMDSLHLKP KK GPKAK R       KDLFR+FP+KKEKPGVV++HAGGV++GSRVPSLGLPR+AEQNSWVIVG+P++ELLIP+Y ERLVAT+SDINL+AKD + E+ +++K RRVTPPPQF+DK K PYD+D+K+DKDLTHDSKREKLK E ++F D+QL+ ACTSTPKM+AP E++N +  TP+S +    RVNL+ + N  G+VLNNQNEILYRERSIDQTTLERLC+RKPEPVQ+WLCDL+ S ENECMTTLQSKPLG EMKA+V++SSATITGNIKKVQTHGQIIVHQYSDV+RQ+E++N+ EEQICLLVANINEFVLAHSITLNTKPPGETP+RWDKIK SLQ+YLQKLIDIGEDVK+ELNES P+W+LVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAMLS++TESSLHEKC+K+MKSI++LPFV+CGVPRALLTAIIESNKSSIKALSLRALATVCVTA+AVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLN+IVDNITG+LSRT+CCQLLLLCTACLVNLVRELELEK+ D+ ++   KSDIV+VF +HRT+E+LLDA+KRRGP+ SVFLQEQTASL++SLSR+ RCVLPLS   AA AALV FAR+ P  A APRAAELRAQARLHCHAAEAI+RLTV+PEVA Q+VQLE VPHL RLVRMQR+RP LD NPDQTLIHCLKALR LY+H+PEAFED K+VE+M+RPHLMESLMLFSAK+ESYV
Sbjct:    1 MSNFQRTRSKVWWGDTPPNIGSPVA-PQPWNQNNRREEQDWEPQLPHWIANQP-EQRNNSTDNIA-PNNAQINQWPLRHGSPGSHKSQDSGFSDSDSSPPTLQYYPPADNSNSTIKSTNSSDSNNNENVTVKQAIDLQNTEHSRDVVDNSLSSNNVSIEAPTPKPRLRSSSVIQTPYDLQKYYEVHTDEEHMDLLKDNDKENDGEPKYPAPTNINNNYEKDNSKKMIDKTIAPKLNKVESK-------KVNNVNPITNKR-------TIQKDTKEVPSSNINIISPSKKYPIKKTFVSSTNSDNSNIIKVAKVKDLETSKNKSDDSLEYIKLSHDNEIAVNNQPRVRTPISNVSYVPTERIAPIKPEYKRSNSNEE--PICTTPKFQRNRLNQSLNFEAQRLDQQILDIQGGYHSLGYIDEDEPKD-IQNQTEPMHKPTKALLGKNIMDSLHLKPNKKPGPKAKQRMVKAERAKDLFRLFPTKKEKPGVVDSHAGGVLNGSRVPSLGLPRSAEQNSWVIVGHPQKELLIPNYTERLVATESDINLKAKDNE-EEINYVKTRRVTPPPQFRDKQKIPYDSDTKSDKDLTHDSKREKLKYE-IDFTDLQLNFACTSTPKMIAPQEFLN-KPQTPRSTKNC--RVNLIGDFN-GGLVLNNQNEILYRERSIDQTTLERLCDRKPEPVQYWLCDLISSNENECMTTLQSKPLGTEMKALVSASSATITGNIKKVQTHGQIIVHQYSDVIRQIESDNTGEEQICLLVANINEFVLAHSITLNTKPPGETPDRWDKIKVSLQMYLQKLIDIGEDVKLELNESNPQWNLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLSENTESSLHEKCSKIMKSITELPFVECGVPRALLTAIIESNKSSIKALSLRALATVCVTAEAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNSIVDNITGILSRTDCCQLLLLCTACLVNLVRELELEKKSDEVNSDEIKSDIVDVFARHRTIEKLLDALKRRGPNTSVFLQEQTASLISSLSRVSRCVLPLSRSAAASAALVWFARSLPSLAPAPRAAELRAQARLHCHAAEAIARLTVIPEVAQQMVQLECVPHLIRLVRMQRSRPPLDTNPDQTLIHCLKALRTLYKHHPEAFEDKKDVEEMIRPHLMESLMLFSAKKESYV 1200          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|930663810|gb|KPJ05304.1| (Protein inscuteable-like [Papilio xuthus])

HSP 1 Score: 1803.88 bits (4671), Expect = 0.000e+0
Identity = 935/1277 (73.22%), Postives = 1059/1277 (82.93%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVAQPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP-SKDVVDNGRTPDVPKG-APTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKD--KEDVSKNEINVTPKNINN--EKCNKDINKTKNISPKVENSKSNVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEE----------------------------------------------------GGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAP--AHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFEDPKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWWGD+PP+IGSPVA    WN NNRREEQDWEPQLPHWIANQP +QRNNS DNIA+PNN QINQWPLRHGSPGSHKSQDSGFSDSDSSPP  QYYP  +++NS  KS +SSDSNNNE++TVK A   QNT  S+DVVDN  + +     APTPKPRLRSSSVIQTPYDLQKYYE+H DEEH+ LLKD  KE+         P NIN   EK N      K I PK+   +S        K+    P NN +        I KDTK+ P+ NVNI+SPSKKYPVKK+FVSST +D++ I KVAKVKDLETSKNKSDESLE+IKL+ DNEIAVNNQPRVRTPISNVSYVPTER+A  + EY+RS SNE+  PI TTPKF+RNRLN+SLNFEAQRLDQQILDIQ GYHSLGYIDE++ K+ ++  TE IHKPTKA+LGKNIMDSLHLKP KK GPKAK R       KD+FRIFP+KKEKPGVV++HAGGV++GSRVPSLGLPR+AEQNSWVIVG+PE+ELLIP Y ERLVAT+SDINL++KD + E+ +++K RRVTPPPQF+DK K PYD+D+K+DKDLTHDSKREKLK + ++F D+QL+ ACTSTPKM+APHE++N  +T PKS +KN  RVNL+ + N  G+VLNNQNEILYRERSIDQTTLERLC+RKPEPVQ+WLCDL+ S ENECMTTLQSKPLG EMKA+V++SSATITGNIKKVQTHGQIIVHQYSD++RQ+E+N++ +EQICLLVANINEFVLAHSITLNTKPPGETPERWDKIK SLQ+YLQKLIDIGEDVK+ELNES P+W+LVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAMLS++TESSLHEKC+K+MKSI++LPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVT +AVKQFEE                                                    GGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLN+IVDNITG+LSRT+CCQLLLLCTACLVNLVRELELEK+ D+     SDIVEV T+HRT+E++LDA+KRRGP+ SVFLQEQTASL++SLSR+ RCVLPLS   A  AALV FAR +P  A APRAAELRAQARLHCHAAEAI+RLTV+PEVA Q+VQLE VPHL RLVRMQR+RP LD NPDQTLIHCLKALR +Y+H PEAFED K+VE+M+RPHLMESLMLFSAKQESYV
Sbjct:    1 MSNFQRTRSKVWWGDTPPNIGSPVAPQPAWNQNNRREEQDWEPQLPHWIANQP-EQRNNSADNIAEPNNAQINQWPLRHGSPGSHKSQDSGFSDSDSSPPTLQYYPPTDNSNSTVKSLNSSDSNNNEDVTVKHAVDLQNTEHSRDVVDNSISSNNISNEAPTPKPRLRSSSVIQTPYDLQKYYEVHTDEEHMDLLKDNDKENDKSEPKYPAPTNINKNYEKDNSKKIIDKAIGPKLNKVESK-------KVNNVNPTNNKR-------TIQKDTKE-PSNNVNIISPSKKYPVKKTFVSSTNSDNSNIIKVAKVKDLETSKNKSDESLEYIKLSHDNEIAVNNQPRVRTPISNVSYVPTERIATVKPEYKRSNSNEE--PICTTPKFQRNRLNQSLNFEAQRLDQQILDIQGGYHSLGYIDEELPKD-IQNQTELIHKPTKALLGKNIMDSLHLKPNKKVGPKAKQRMVKTERAKDIFRIFPTKKEKPGVVDSHAGGVLNGSRVPSLGLPRSAEQNSWVIVGHPEKELLIPHYTERLVATESDINLKSKDNE-EEINYVKTRRVTPPPQFRDKQKIPYDSDTKSDKDLTHDSKREKLKYD-IDFTDLQLNFACTSTPKMIAPHEFLNNPQT-PKSNKKNSCRVNLIGDFN-GGLVLNNQNEILYRERSIDQTTLERLCDRKPEPVQYWLCDLISSYENECMTTLQSKPLGTEMKALVSASSATITGNIKKVQTHGQIIVHQYSDIIRQIESNDTGQEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKISLQMYLQKLIDIGEDVKLELNESNPQWNLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLSENTESSLHEKCSKIMKSITELPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTGEAVKQFEEGGGIEILSDILSDRSNPEPQMREGITVLTQITAPWLRGHYDLTQLHLYLNSIGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNSIVDNITGILSRTDCCQLLLLCTACLVNLVRELELEKKSDE--GTNSDIVEVITRHRTIEKVLDALKRRGPNTSVFLQEQTASLISSLSRVSRCVLPLSRSAAVSAALVWFARTSPSLAPAPRAAELRAQARLHCHAAEAIARLTVIPEVAQQMVQLECVPHLIRLVRMQRSRPPLDTNPDQTLIHCLKALRTIYKHYPEAFEDKKDVEEMIRPHLMESLMLFSAKQESYV 1252          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|512902600|ref|XP_004925416.1| (PREDICTED: uncharacterized protein LOC101741429 [Bombyx mori])

HSP 1 Score: 1768.05 bits (4578), Expect = 0.000e+0
Identity = 936/1232 (75.97%), Postives = 1052/1232 (85.39%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVAQPADWNHNNR-REEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTPSK-DVVDNGRT-PDVPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKE--DVSKNEINVTPKNINNEKCNKDINKTKNISPKVENSKSNVEPGNKIKIKVTPPNNN---NK-ENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKN-KSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNL-PITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDK-KDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLK--EEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAPAHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFED-PKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWWGDSPP++GSPVAQPA+WN +NR REEQ WEPQLPHWIANQP+QQRNNS DNIAQPN  QINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYY  PE+N SNNKSSSSSDSNNNEN+T+K  E F NTP   DVVD+ RT P+     PTPKPRLRSSSVIQTPYDLQKYYEIH DEEH+ LLKDK   + +KNE   + K +NN+  NK+   TK IS K      N +  N +K      NNN   NK  N  ++S I  DTK+VP KN++ LSPSKKYP+KKS VS+TE DS K+ K+AKVKDLET+ N KSDESLE+IKL+D+NEIAVNNQPRVRTPISN+SYVPTER    + +Y RS+SNE+N  P+TT+P+FERNRLNKSLNFEAQ+LDQQILDIQ+G+HSLGYIDED   +E++ S +QI  P K +L KNIMDSLHLKP KKAGPKAK R ATK+D+ K+LFRIFP KKEK  VV THAGG + GSRVP LGLPR+ + N+WVIVGYPE E+LIP YNERLVATDSD+NL++KD    + + +KN RVTPPPQFQDK KTPY++ +KTDK+LTHDSKREKLK  EE+LNF D+QLDLAC STPKMLAP E+MNG+     S R+N  R NL+ + N S VVLNNQNEILYRERSIDQT LERLCERKPEPVQHWLCDL+GS E+ECMTTLQSKP+GAEMKAMV++SSATITGNIKKVQTHGQIIVHQYSDVLRQ+E +  SEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNES  EW LV KHLDTLI IFLETTKAVL+QQMKTLVSIIEEPPSDM+LKSTLTSIGHLAMLS+ TESSLHEKC+K+MKSI++LPFVDC VPRALLTAIIE+NKSSIKALSLRALATVCVT DAVKQFEEGGGIEI+SDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHL+L+ IV+NITG+LSRT+CCQLLLLCTACLVNLVRELE+EKR+ D +  KSDIVEV  KH TVERLLDAVKRRGP ISVFLQEQTASL++ L+ +PRCVL LS      AALVCF R+ P+   RAAELRAQ RLHCHA EAI+RL+V+P+VAHQIVQLEGVPHL RLVR QRTRPH + NPDQTLIHCLKALRN+++H PEAFE+  K+V++M+RPHLMESLMLFSAKQESYV
Sbjct:    1 MSNFQRTRSKVWWGDSPPNLGSPVAQPAEWNRDNRTREEQQWEPQLPHWIANQPEQQRNNSADNIAQPN-AQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYAPPETNESNNKSSSSSDSNNNENVTIKHVE-FVNTPQNVDVVDSSRTSPN--NEVPTPKPRLRSSSVIQTPYDLQKYYEIHRDEEHMDLLKDKGPGEENKNEDENSHKKVNNDNLNKE--NTKPISSK------NYKACNVLK------NNNATLNKISNKELLSPIKHDTKEVPIKNISALSPSKKYPLKKSLVSNTENDSAKVIKLAKVKDLETNNNNKSDESLEYIKLSDNNEIAVNNQPRVRTPISNISYVPTER--STKPKYNRSISNENNSSPLTTSPRFERNRLNKSLNFEAQKLDQQILDIQDGHHSLGYIDEDTPTDEVQYSKKQIENPIKTLLAKNIMDSLHLKPNKKAGPKAKQRMATKADRTKELFRIFP-KKEKTTVVGTHAGGTMDGSRVPPLGLPRSNDHNNWVIVGYPEVEMLIPHYNERLVATDSDLNLKSKDQPEHENNDIKNSRVTPPPQFQDKQKTPYESHTKTDKNLTHDSKREKLKFREEDLNFADVQLDLACMSTPKMLAPDEFMNGRN----SGRQNQSRTNLMTDFNRSRVVLNNQNEILYRERSIDQTQLERLCERKPEPVQHWLCDLIGSYESECMTTLQSKPIGAEMKAMVSASSATITGNIKKVQTHGQIIVHQYSDVLRQIEDSKPSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESNVEWYLVLKHLDTLIDIFLETTKAVLIQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLSEPTESSLHEKCSKIMKSITELPFVDCAVPRALLTAIIETNKSSIKALSLRALATVCVTGDAVKQFEEGGGIEIISDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLFLDKIVENITGILSRTDCCQLLLLCTACLVNLVRELEVEKRDGDRT--KSDIVEVMDKHHTVERLLDAVKRRGPYISVFLQEQTASLVSVLAGVPRCVLALSRAGRVCAALVCFTRSPPSPPARAAELRAQTRLHCHATEAIARLSVIPDVAHQIVQLEGVPHLIRLVRSQRTRPHPEKNPDQTLIHCLKALRNIFKHIPEAFEEYQKDVQEMIRPHLMESLMLFSAKQESYV 1205          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|357609199|gb|EHJ66342.1| (putative inscuteable [Danaus plexippus])

HSP 1 Score: 1729.53 bits (4478), Expect = 0.000e+0
Identity = 902/1221 (73.87%), Postives = 1031/1221 (84.44%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVAQPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP--SKDVVDNGRTPDVPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKEDVSKNEINVTPKNINNEKCNKD-INKTKNISPKVENSKSNVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEE-MEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAPAHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFEDPKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWWGDSPP+IGSPVAQP +WN NN+R E +WEPQLPHWI NQP +QRNNS DN+AQ NN+  NQWPLRHGSPGSHKSQDSGFSDSDSSPP SQYY SP   N  NKS++SSDSNNNEN+T+KQA  +QN+   SKD VD     +V    PTPKPRLRSSSVIQTPYDLQ+Y+E+H D+EH+ LLKDK+       +   KN+N++   KD +NK+ + +    N K N    N IK        NNKEN+P  SAI  D KD   KN+NILSPSKKYP KK     ++ + T I K+A VKDL+T+KNK D+SLE+I+L+ +NEIAVNNQPRVRTPI+NVSYVPTE+++ ++ EYRRS+SNE+N+ ITTTPKF+RNRLN+SLN E Q+LD+QIL IQEGYHSLGYIDE+ +  +      EQ+HKPTKA+LGKNIMDSLHLKP+KK GPKAKHR A K   K+ FR+F ++KEKPGVV+  AGGV+ GSRVPSLGLPRT++QNSWV+VG+P++E+LIP YNERLV TDSDINL++KD QN     +   R+TPPPQFQDK K PY+++SKTDK LTHDSKREKLK++  +F D+QLDL CTSTPKMLAPHE+M    T   S  K  RRVNLL+N N SG+VLNN++EILYRERSIDQT LERLC+RKPEPVQ+WLCDLVGSCENECMTTLQSKPLGAEMKAMV+S+SATITGNIKKVQTHGQIIVHQYSDVLRQME NN+SEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIK SLQ+YLQKLIDIGEDVK+ELNESRPEW+LVQKHLDTLI IFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAML+++TESSLH KCTK+MKSI++LPFVDCGVPRALLTAIIES KSSIKALSLRALATVCVT +AVKQFEEGGGIEILSDILSD SNPEPQMREAITVLTQITAPWLRGHYD+TQLH+YL+ I+ +IT +L RTECCQLLLLCTACLVNLVRELELEK+ED    A SDI+EV  K+ TVE+LLDAVKRRGP+ISVFLQEQTASLLASLSR+ RC+LPLS    A  ALVCFAR+ P  A RAAELRA  RLHCH AEAISRL V+P+VAHQIVQLEG+PHL RLVRMQRTRPH+D NPDQTLIH LKALR L++H PEAF D K+V +M++PHLMESLMLFSAKQESYV
Sbjct:    1 MSNFQRTRSKVWWGDSPPNIGSPVAQP-EWNQNNQRVEPEWEPQLPHWI-NQP-EQRNNSADNLAQANNLP-NQWPLRHGSPGSHKSQDSGFSDSDSSPPTSQYY-SPSDENDKNKSNNSSDSNNNENVTIKQAAEYQNSHHNSKDEVDYS---NVNVNTPTPKPRLRSSSVIQTPYDLQEYFEVHQDQEHMDLLKDKK------FDEIQKNLNDDNQRKDKLNKSFDTALN-SNLKRNAH-NNSIKSMT----QNNKENTPNSSAIENDAKD---KNLNILSPSKKYPAKKITTGDSDCNQT-IVKMATVKDLDTNKNKCDDSLEYIRLSHNNEIAVNNQPRVRTPITNVSYVPTEKISSSKPEYRRSMSNEENIAITTTPKFQRNRLNQSLNLEGQKLDRQILQIQEGYHSLGYIDEEELPNQPAVYPKEQVHKPTKALLGKNIMDSLHLKPSKKVGPKAKHRSAGKDKAKEAFRLFSNRKEKPGVVDKLAGGVLDGSRVPSLGLPRTSDQNSWVVVGHPQKEMLIPHYNERLVHTDSDINLKSKDVQN---GKVDKNRLTPPPQFQDKQKIPYESNSKTDKVLTHDSKREKLKDDYTSFMDVQLDLGCTSTPKMLAPHEFM----TDVLSSNKKPRRVNLLQNFN-SGLVLNNRDEILYRERSIDQTNLERLCDRKPEPVQYWLCDLVGSCENECMTTLQSKPLGAEMKAMVSSNSATITGNIKKVQTHGQIIVHQYSDVLRQMETNNTSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKMSLQMYLQKLIDIGEDVKVELNESRPEWNLVQKHLDTLIDIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLTENTESSLHVKCTKIMKSITELPFVDCGVPRALLTAIIESKKSSIKALSLRALATVCVTGEAVKQFEEGGGIEILSDILSDSSNPEPQMREAITVLTQITAPWLRGHYDITQLHVYLDNIIKHITDILCRTECCQLLLLCTACLVNLVRELELEKKED----ADSDIIEVINKYHTVEKLLDAVKRRGPNISVFLQEQTASLLASLSRVSRCILPLSRSPVASVALVCFARSGPL-ATRAAELRATHRLHCHTAEAISRLAVIPDVAHQIVQLEGIPHLIRLVRMQRTRPHVDENPDQTLIHTLKALRTLHKHYPEAFNDEKDVNEMIKPHLMESLMLFSAKQESYV 1184          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|930678918|gb|KPJ18837.1| (5-oxoprolinase [Papilio machaon])

HSP 1 Score: 1587.39 bits (4109), Expect = 0.000e+0
Identity = 822/1076 (76.39%), Postives = 927/1076 (86.15%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVA-QPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP-SKDVVDNGRTPD-VPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKD--KEDVSKNEINVTPKNINN--EKCNKDINKTKNISPK---VENSKSNVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQ 1066
            MSNFQRTRSKVWWGDSPP+IGSPVA QPA WN NNRREEQDWEPQLPHWIANQP +QRNNS DNIA+PNN QINQWPLRHGSPGSHKSQDSGFSDSDSSPP  QYYP  +++NS  KS++SSDSNNNENITVK A   QNT  S+DVVDN R+ D +   AP PKPRLRSSSVIQTPYDLQKYYE+H DEEH+ LLKD  KE+         P NIN   EK N      K I PK   +EN K N          V P  N           I KDTK+VP+ NVNI+SPSKKYPVKK+FVSST +D++ I K+AKVKDLETSKNKSDESLE+IKL+ DNEIAV+NQPRVRTPISNVSYVPTER+A  + +Y+RS SNE+  PI TTPKF+RNRLN+SLNFEAQRLDQQILDIQ GYHSLGYIDED   + ++  TE +HKPTKA+LGKNIMDSLHLKP KK GPKAK R       KD+FRIFPSKKEKPGVV++HAGGV++GSRVPSLGLPR+ EQNSWVIVG+PE+ELLIP+Y ERLVAT+SDINL++KD + E+ +++K RRVTPPPQF+DK K PYD+DSK+DKDLTHDSKREKLK + ++F D+QL+ ACTSTPKM+AP E+MN  +T PKS +KN  RVNL+ + N  G+VLNNQNEILYRERSIDQTTLERLC+RKPEPVQ+WLCDL+ S ENECMTTLQSKPLG EMKA+V++SSATITGNIKKVQTHGQIIVHQYSDV+RQ+E+NN+ EEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIK SLQ+YLQKLIDIGEDVK+ELNES P+W+LVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAMLS++TES LHEKC+K+MKSI++LPFV+CGVPRALLTAIIESNKSSIKALSLRALATVCVTA+AVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPW+RGHYDLTQLHLYLN+IVDNITG+LSRT+CCQLLLLCTACLVNLVRELELEK+ D+     SDIVEV ++HRT+E+LLDA+KRRGP+ SVFLQ
Sbjct:    1 MSNFQRTRSKVWWGDSPPNIGSPVAPQPA-WNQNNRREEQDWEPQLPHWIANQP-EQRNNSADNIAEPNNAQINQWPLRHGSPGSHKSQDSGFSDSDSSPPTLQYYPPADNSNSTVKSANSSDSNNNENITVKHAVDLQNTEHSRDVVDNSRSSDNISNEAPIPKPRLRSSSVIQTPYDLQKYYEVHTDEEHMDLLKDNDKENDKSEPKYPAPTNINKNYEKDNSKKMIDKTIGPKLNKIENKKIN---------NVNPTINK--------RTIQKDTKEVPSNNVNIISPSKKYPVKKNFVSSTNSDNSNIIKLAKVKDLETSKNKSDESLEYIKLSHDNEIAVHNQPRVRTPISNVSYVPTERIATVKPDYKRSNSNEE--PICTTPKFQRNRLNQSLNFEAQRLDQQILDIQGGYHSLGYIDEDESIKNIQNQTEPMHKPTKALLGKNIMDSLHLKPNKKVGPKAKQRMVKAERTKDIFRIFPSKKEKPGVVDSHAGGVLNGSRVPSLGLPRSTEQNSWVIVGHPEKELLIPNYTERLVATESDINLKSKDNE-EEINYVKTRRVTPPPQFRDKQKIPYDSDSKSDKDLTHDSKREKLKYD-IDFTDLQLNFACTSTPKMIAPQEFMNNPQT-PKSNKKNSCRVNLIGDFN-GGLVLNNQNEILYRERSIDQTTLERLCDRKPEPVQYWLCDLISSNENECMTTLQSKPLGTEMKALVSASSATITGNIKKVQTHGQIIVHQYSDVIRQIESNNTGEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKVSLQMYLQKLIDIGEDVKLELNESNPQWNLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLSENTESLLHEKCSKIMKSITELPFVECGVPRALLTAIIESNKSSIKALSLRALATVCVTAEAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWMRGHYDLTQLHLYLNSIVDNITGILSRTDCCQLLLLCTACLVNLVRELELEKKFDE--GTNSDIVEVISRHRTIEKLLDALKRRGPNTSVFLQ 1049          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|943938768|ref|XP_014371075.1| (PREDICTED: uncharacterized protein LOC106720801 [Papilio machaon])

HSP 1 Score: 1585.85 bits (4105), Expect = 0.000e+0
Identity = 822/1076 (76.39%), Postives = 927/1076 (86.15%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVA-QPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTP-SKDVVDNGRTPD-VPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKD--KEDVSKNEINVTPKNINN--EKCNKDINKTKNISPK---VENSKSNVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQ 1066
            MSNFQRTRSKVWWGDSPP+IGSPVA QPA WN NNRREEQDWEPQLPHWIANQP +QRNNS DNIA+PNN QINQWPLRHGSPGSHKSQDSGFSDSDSSPP  QYYP  +++NS  KS++SSDSNNNENITVK A   QNT  S+DVVDN R+ D +   AP PKPRLRSSSVIQTPYDLQKYYE+H DEEH+ LLKD  KE+         P NIN   EK N      K I PK   +EN K N          V P  N           I KDTK+VP+ NVNI+SPSKKYPVKK+FVSST +D++ I K+AKVKDLETSKNKSDESLE+IKL+ DNEIAV+NQPRVRTPISNVSYVPTER+A  + +Y+RS SNE+  PI TTPKF+RNRLN+SLNFEAQRLDQQILDIQ GYHSLGYIDED   + ++  TE +HKPTKA+LGKNIMDSLHLKP KK GPKAK R       KD+FRIFPSKKEKPGVV++HAGGV++GSRVPSLGLPR+ EQNSWVIVG+PE+ELLIP+Y ERLVAT+SDINL++KD + E+ +++K RRVTPPPQF+DK K PYD+DSK+DKDLTHDSKREKLK + ++F D+QL+ ACTSTPKM+AP E+MN  +T PKS +KN  RVNL+ + N  G+VLNNQNEILYRERSIDQTTLERLC+RKPEPVQ+WLCDL+ S ENECMTTLQSKPLG EMKA+V++SSATITGNIKKVQTHGQIIVHQYSDV+RQ+E+NN+ EEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIK SLQ+YLQKLIDIGEDVK+ELNES P+W+LVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAMLS++TES LHEKC+K+MKSI++LPFV+CGVPRALLTAIIESNKSSIKALSLRALATVCVTA+AVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPW+RGHYDLTQLHLYLN+IVDNITG+LSRT+CCQLLLLCTACLVNLVRELELEK+ D+     SDIVEV ++HRT+E+LLDA+KRRGP+ SVFLQ
Sbjct:    1 MSNFQRTRSKVWWGDSPPNIGSPVAPQPA-WNQNNRREEQDWEPQLPHWIANQP-EQRNNSADNIAEPNNAQINQWPLRHGSPGSHKSQDSGFSDSDSSPPTLQYYPPADNSNSTVKSANSSDSNNNENITVKHAVDLQNTEHSRDVVDNSRSSDNISNEAPIPKPRLRSSSVIQTPYDLQKYYEVHTDEEHMDLLKDNDKENDKSEPKYPAPTNINKNYEKDNSKKMIDKTIGPKLNKIENKKIN---------NVNPTINK--------RTIQKDTKEVPSNNVNIISPSKKYPVKKNFVSSTNSDNSNIIKLAKVKDLETSKNKSDESLEYIKLSHDNEIAVHNQPRVRTPISNVSYVPTERIATVKPDYKRSNSNEE--PICTTPKFQRNRLNQSLNFEAQRLDQQILDIQGGYHSLGYIDEDESIKNIQNQTEPMHKPTKALLGKNIMDSLHLKPNKKVGPKAKQRMVKAERTKDIFRIFPSKKEKPGVVDSHAGGVLNGSRVPSLGLPRSTEQNSWVIVGHPEKELLIPNYTERLVATESDINLKSKDNE-EEINYVKTRRVTPPPQFRDKQKIPYDSDSKSDKDLTHDSKREKLKYD-IDFTDLQLNFACTSTPKMIAPQEFMNNPQT-PKSNKKNSCRVNLIGDFN-GGLVLNNQNEILYRERSIDQTTLERLCDRKPEPVQYWLCDLISSNENECMTTLQSKPLGTEMKALVSASSATITGNIKKVQTHGQIIVHQYSDVIRQIESNNTGEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKVSLQMYLQKLIDIGEDVKLELNESNPQWNLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLSENTESLLHEKCSKIMKSITELPFVECGVPRALLTAIIESNKSSIKALSLRALATVCVTAEAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWMRGHYDLTQLHLYLNSIVDNITGILSRTDCCQLLLLCTACLVNLVRELELEKKFDE--GTNSDIVEVISRHRTIEKLLDALKRRGPNTSVFLQ 1049          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|768422045|ref|XP_011551857.1| (PREDICTED: uncharacterized protein LOC105383505, partial [Plutella xylostella])

HSP 1 Score: 1576.22 bits (4080), Expect = 0.000e+0
Identity = 818/1139 (71.82%), Postives = 938/1139 (82.35%), Query Frame = 0
Query:   99 PPPSQYYPSPESNNSNNKSSSSSDS---NNNENITVKQAEGFQN-TPSKDVVDNGRTPD------VPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKEDVSKNEINVTPKNINNEKCNKDINKTKNISPKVENSKSNV-EPGNKIKIKVTPPNN-NNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAV-ARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDV---IKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEE---LNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAPAHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAF-EDPKEVEQMVRPHLMESLMLFSAKQESYV 1217
            PPPSQYY +   NN +  S  SS S   NNNENITVK    F++   SKD VDN RTPD      VP  AP PKPRLRSSSV+QT YDLQ YY ++ ++EH +LLKD ++V  +     PK        + INK K+      +  +N+ + GNKI+IK+TPPNN +NKEN+P   AI K+TK++  ++  I+SPSKKYP KKSFV+S   +ST  SKVA VKDL+TSKNKSD+SLE+IKLAD+N IAVNNQP VR+PISN+SYVPTER +   +AEYRRSLS+E+N+P   TPKF+RNRLNKSLNFEAQRLDQQILDIQEGYHSL YIDED    IK E E     IH+P+ AILGKNIMDSLHLKPTKK GPKAK R           +IF SKK+K  + E++AGG++ GSRVPSLGLPR +E NSWVIVG+PE E+LIP+Y ERL+    DI    K  + +DT+F   +++ PPPQFQDK KTPY TDSK DKDLTHDSKREKLK+++   +NF D+QL+LACTSTPKMLAPHE+M G   TPKS  KN RR+NLL+N N  GVVLN+Q+E+LYRERSIDQT LERLCERKPEPVQHWLCDLVG+CENECMTTLQSKPLGAEMKA+V++SSATITGNIKKVQTHGQIIVHQYSDV+RQ++  N SE+QICLL+ANINEFVL HSITLNTKPPGETPERWDKIKKSLQ YL+KLI+IG+DVKIELNES P+W +V KHLD LIGIF+ETTKAVLVQQMKTLVSIIEEPPSDM+LKSTLTSIGHLAML+++TESSLHEKC +++KSI++LPFVDCGVPRALLTAIIESNKSSIKALSLRALAT+CV  DAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQ+HLYL++IVDNITG+LSRT CCQLLLLCTACLVNLVRELELE++E +     SD+VE  TKHRTVERLLDAVKRRGP+ISVFLQEQTASLLASLSRI RCVL LS L++   A VCF RA+PA  PRAAELRAQARLHCHAAEAISRL V+P+VA QIVQLEGVPHL RLVRMQR RP  DVNPDQTLIHCLKALR +++H+  AF E  K+VE M+RPHLMESLMLFSAKQESYV
Sbjct:    1 PPPSQYYAT--DNNDSKVSKQSSSSSDSNNNENITVKHIVDFESKAESKDEVDNERTPDITVNYIVPTKAPVPKPRLRSSSVVQTSYDLQNYYAMNHEQEHKKLLKDIQEVECDMNQTVPKAEPRYPAPRLINKNKSNKENTISDNTNITKIGNKIEIKITPPNNISNKENTPNKGAIEKETKEIAVEDDTIISPSKKYPPKKSFVASK--NSTITSKVAVVKDLDTSKNKSDDSLEYIKLADNNVIAVNNQPSVRSPISNISYVPTERTSSKTKAEYRRSLSHEENVPTPITPKFQRNRLNKSLNFEAQRLDQQILDIQEGYHSLEYIDEDPKINIKNEKE-----IHQPSTAILGKNIMDSLHLKPTKKVGPKAKQRT----------KIFSSKKDKVDIAESYAGGILEGSRVPSLGLPRVSEHNSWVIVGHPEPEMLIPNYTERLI----DIGTIPK--EKDDTNF-DIKKLPPPPQFQDKQKTPYKTDSKNDKDLTHDSKREKLKDDDFKDMNFTDVQLNLACTSTPKMLAPHEFM-GDMRTPKSTTKNTRRINLLDNFN--GVVLNSQDELLYRERSIDQTALERLCERKPEPVQHWLCDLVGACENECMTTLQSKPLGAEMKALVSASSATITGNIKKVQTHGQIIVHQYSDVIRQIDTKNISEDQICLLIANINEFVLTHSITLNTKPPGETPERWDKIKKSLQKYLEKLIEIGDDVKIELNESLPQWDVVMKHLDGLIGIFIETTKAVLVQQMKTLVSIIEEPPSDMILKSTLTSIGHLAMLAENTESSLHEKCLEIVKSITELPFVDCGVPRALLTAIIESNKSSIKALSLRALATICVNGDAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQMHLYLDSIVDNITGILSRTSCCQLLLLCTACLVNLVRELELERKEGEGREG-SDVVEAITKHRTVERLLDAVKRRGPNISVFLQEQTASLLASLSRIARCVLLLSRLSSGSVARVCFTRASPAQRPRAAELRAQARLHCHAAEAISRLCVIPDVAQQIVQLEGVPHLIRLVRMQRKRPQDDVNPDQTLIHCLKALRTIFKHHQSAFLEYEKDVEDMIRPHLMESLMLFSAKQESYV 1109          
BLAST of HiSeq38296 vs. genbank:protein
Match: gi|914576410|gb|KOB78290.1| (putative inscuteable, partial [Operophtera brumata])

HSP 1 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 797/1238 (64.38%), Postives = 911/1238 (73.59%), Query Frame = 0
Query:    1 MSNFQRTRSKVWWGDSPPSIGSPVAQPADWNHNNRREEQDWEPQLPHWIANQPDQQRNNSIDNIAQPN-NVQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTPSKDVVDNGRTPD-VPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKE--DVSKNEINV-TPKNINNEKCNKDIN---KTKNISPKVENSKSNVEPGNKIKIKVTPPNNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDSTKISKVAKVKDLETSKN-KSDESLEFIKLADDNEIAVNNQPRVRTPISNVSYVPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKPTKKAGPKAKHRFATKSDK-KDLFRIFPSKKEKPGVVETHAGGVVSGSRVPSLGLPRTAEQNSWVIVGYP-EQELLIPSYNERLVATDSDINLRAKDTQNEDTSFLKNRR--VTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKE---EELNFGDMQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKN-IRRVNLLENINTSGVVLNNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQSKPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSEEQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDIGEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEEPPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILSDRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNT---IVDNITGLLSRTECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERLLDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFARAAPAHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLTRLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFED-PKEVEQMVRPHLMESLMLFSAKQESYV 1217
            MSNFQRTRSKVWWGD P + GSPVAQP   N NN  +E +WEPQLPHWIAN+P+QQ NNS DNI  PN  +QINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQY+ SP   N +  +SSSSDSNNNENITVKQA  FQNTP KDVVD+ + PD +  GAPTPKPR RSSS+IQTPYDLQKYYEIH DEEH++LLKD +  D++K E    TPKN+NNEK NK  +   K+ N    ++N+ +      K    +TP  N   ++SP  SAI  +TKDV  KN+NI+SPSKKYPVK +FVSS E  +  I KVA VKDLETSKN KSDE++E IKL D+NEIAV NQPR+RTPISNVSYVPTER ++A+ EY+RS SNE  LPITTTP F+R RLNKSLNFE QRLDQQILDIQ+GYHSLG+I+EDV  EE     EQ+HKP KA+LGKNIMDSLHLKP KK GPKAKHR A K+DK KD+FRIFP KKEKPG V++HAGG + GSRVPSLGLPR+A+ +SWV VGYP +QELLIP YNERLV  +SD+   AKD +N     LK+R   VTPPPQFQD+ KTP + D KTDKDL+HDSKREK K+   +  NF +++++LA TSTPKMLAPHEYMN   +T  S RK+  RR NL  ++N  G+VLNNQNEILYRERSIDQT LERLCERKPEPVQ+WLC+L  S ENECMTTLQSKPLGAE+KA V                              Q+E+N  SE+QICLLVANINEFVLAHSITLNTKPPGETPERWDKIK+SLQLYLQKLIDIGEDVK+ELNE+ PEW+L                         TLVSIIEEPPSD++LKSTLTSIGHLAMLS+  ES++HE+C KVMK I++LPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQ      +  L          +P   +A            RG++     H  L       D    +LSRTECCQLLLLCTACLVNLVRELELE+ ED  S   SDIVE+ TKHRTVERLLDAVKRRGP+ISVFLQEQTASLL SLSRIPRC+  LS + A   AL                           +   +RL+V+P+VAHQIVQLEGVPHLTRLVR QRTRP +D NPDQTLIHCLKALR LY+H P AF D  K+V +M+RPHLMESLMLFSAKQESYV
Sbjct:    1 MSNFQRTRSKVWWGDEPAAAGSPVAQP---NWNNPAKEPEWEPQLPHWIANEPEQQNNNSADNIPPPNVQIQINQWPLRHGSPGSHKSQDSGFSDSDSSPPPSQYF-SPPDTNDSKNNSSSSDSNNNENITVKQAIDFQNTPHKDVVDSAKEPDTISNGAPTPKPRNRSSSLIQTPYDLQKYYEIHTDEEHMELLKDNDTGDLNKTEPKYPTPKNMNNEKLNKSKSTNVKSTNYPKIIKNNVNVNNKAEK---NLTPTKNVIIQDSPNKSAIQTETKDVHDKNLNIISPSKKYPVK-AFVSSPEGATNAI-KVATVKDLETSKNNKSDENVEIIKLCDNNEIAVKNQPRMRTPISNVSYVPTERSSIAKKEYKRSFSNEYELPITTTPVFQRTRLNKSLNFEGQRLDQQILDIQDGYHSLGFINEDV-DEETFPEIEQVHKPKKALLGKNIMDSLHLKPQKKVGPKAKHR-ANKADKTKDMFRIFP-KKEKPGTVDSHAGGTLKGSRVPSLGLPRSADHDSWVFVGYPADQELLIPHYNERLVG-ESDVK-SAKDQEN----ILKDRLSPVTPPPQFQDE-KTPNEADFKTDKDLSHDSKREKFKDPRDDGGNFAEVRMNLASTSTPKMLAPHEYMNSLHST--SGRKSQTRRENLYHDLN--GLVLNNQNEILYRERSIDQTKLERLCERKPEPVQYWLCELASSSENECMTTLQSKPLGAEVKAQV------------------------------QIESNQISEDQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKRSLQLYLQKLIDIGEDVKVELNETTPEWTL-------------------------TLVSIIEEPPSDLILKSTLTSIGHLAMLSEGPESAIHERCAKVMKEITELPFVDCGVPRALLTAIIESNKSSIKALSLRALATVCVTADAVKQH----SVRPL----------QPGAADA------------RGYHGADADHGALAARPLRPDAAPRILSRTECCQLLLLCTACLVNLVRELELERAED--SNPTSDIVEIITKHRTVERLLDAVKRRGPNISVFLQEQTASLLVSLSRIPRCMAALSRVRAVSVALSI------------------------TSFMFNRLSVMPDVAHQIVQLEGVPHLTRLVRAQRTRPTVDTNPDQTLIHCLKALRILYKHCPVAFNDYEKDVGEMIRPHLMESLMLFSAKQESYV 1108          
The following BLAST results are available for this feature:
BLAST of HiSeq38296 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913320594|ref|XP_013191419.1|0.000e+080.93PREDICTED: uncharacterized protein LOC106135609 [A... [more]
gi|910336302|ref|XP_013171661.1|0.000e+076.26PREDICTED: uncharacterized protein LOC106120779 [P... [more]
gi|909549969|ref|XP_013149038.1|0.000e+076.35PREDICTED: uncharacterized protein LOC106111465 [P... [more]
gi|930663810|gb|KPJ05304.1|0.000e+073.22Protein inscuteable-like [Papilio xuthus][more]
gi|512902600|ref|XP_004925416.1|0.000e+075.97PREDICTED: uncharacterized protein LOC101741429 [B... [more]
gi|357609199|gb|EHJ66342.1|0.000e+073.87putative inscuteable [Danaus plexippus][more]
gi|930678918|gb|KPJ18837.1|0.000e+076.395-oxoprolinase [Papilio machaon][more]
gi|943938768|ref|XP_014371075.1|0.000e+076.39PREDICTED: uncharacterized protein LOC106720801 [P... [more]
gi|768422045|ref|XP_011551857.1|0.000e+071.82PREDICTED: uncharacterized protein LOC105383505, p... [more]
gi|914576410|gb|KOB78290.1|0.000e+064.38putative inscuteable, partial [Operophtera brumata... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005488 binding
molecular_function GO:0003824 catalytic activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 864..1185
e-value: 1.1E-11
score: 43.2
NoneNo IPR availablePANTHERPTHR21386INSCUTEABLEcoord: 630..1217
NoneNo IPR availablePANTHERPTHR21386:SF0PROTEIN INSCUTEABLE HOMOLOGcoord: 630..1217
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 841..1193

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq38296HiSeq38296Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq38296_p ID=HiSeq38296_p|Name=HiSeq38296|organism=Ostrinia scapulalis|type=polypeptide|length=1217bp
MSNFQRTRSKVWWGDSPPSIGSPVAQPADWNHNNRREEQDWEPQLPHWIA
NQPDQQRNNSIDNIAQPNNVQINQWPLRHGSPGSHKSQDSGFSDSDSSPP
PSQYYPSPESNNSNNKSSSSSDSNNNENITVKQAEGFQNTPSKDVVDNGR
TPDVPKGAPTPKPRLRSSSVIQTPYDLQKYYEIHCDEEHIQLLKDKEDVS
KNEINVTPKNINNEKCNKDINKTKNISPKVENSKSNVEPGNKIKIKVTPP
NNNNKENSPVVSAIHKDTKDVPAKNVNILSPSKKYPVKKSFVSSTETDST
KISKVAKVKDLETSKNKSDESLEFIKLADDNEIAVNNQPRVRTPISNVSY
VPTERLAVARAEYRRSLSNEDNLPITTTPKFERNRLNKSLNFEAQRLDQQ
ILDIQEGYHSLGYIDEDVIKEEMEQSTEQIHKPTKAILGKNIMDSLHLKP
TKKAGPKAKHRFATKSDKKDLFRIFPSKKEKPGVVETHAGGVVSGSRVPS
LGLPRTAEQNSWVIVGYPEQELLIPSYNERLVATDSDINLRAKDTQNEDT
SFLKNRRVTPPPQFQDKLKTPYDTDSKTDKDLTHDSKREKLKEEELNFGD
MQLDLACTSTPKMLAPHEYMNGQKTTPKSVRKNIRRVNLLENINTSGVVL
NNQNEILYRERSIDQTTLERLCERKPEPVQHWLCDLVGSCENECMTTLQS
KPLGAEMKAMVTSSSATITGNIKKVQTHGQIIVHQYSDVLRQMEANNSSE
EQICLLVANINEFVLAHSITLNTKPPGETPERWDKIKKSLQLYLQKLIDI
GEDVKIELNESRPEWSLVQKHLDTLIGIFLETTKAVLVQQMKTLVSIIEE
PPSDMLLKSTLTSIGHLAMLSDSTESSLHEKCTKVMKSISDLPFVDCGVP
RALLTAIIESNKSSIKALSLRALATVCVTADAVKQFEEGGGIEILSDILS
DRSNPEPQMREAITVLTQITAPWLRGHYDLTQLHLYLNTIVDNITGLLSR
TECCQLLLLCTACLVNLVRELELEKREDDTSAAKSDIVEVFTKHRTVERL
LDAVKRRGPSISVFLQEQTASLLASLSRIPRCVLPLSHLTAAVAALVCFA
RAAPAHAPRAAELRAQARLHCHAAEAISRLTVVPEVAHQIVQLEGVPHLT
RLVRMQRTRPHLDVNPDQTLIHCLKALRNLYRHNPEAFEDPKEVEQMVRP
HLMESLMLFSAKQESYV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0005488binding
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
IPR011989ARM-like