OSCA017079-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA017079-RA
Unique NameOSCA017079-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length181
Homology
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|914568134|gb|KOB72168.1| (putative diaphanous [Operophtera brumata])

HSP 1 Score: 137.117 bits (344), Expect = 2.367e-35
Identity = 86/175 (49.14%), Postives = 108/175 (61.71%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTSEIGDRSYLITVLVSRNLYLSPKERKMGSKKRDKNRNGDYTXLLQSRLYSNDIRH-----SVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTGE-RERRRQNETE 172
            Q DL HSM +KMEALY ELAEY+ FDP KY L+EFF+D+KTFKDSF      RS    +    ++Y   K+ +    +R +    D         +S D++        AKE RSQCDLLHSM +KMEALY ELAEY+ FDP KY L++FF+D+KTFKDSF    +E     ETE
Sbjct:  205 QCDLLHSMYKKMEALYSELAEYYCFDPLKYTLDEFFSDIKTFKDSFMFAKEARSQCDLL---HSMY---KKMEALYSERAEYYCFDPLKYTLDEFFS-DMKTFKDSFVFAKEARSQCDLLHSMYKKMEALYSELAEYYCFDPLKYTLDKFFSDIKTFKDSFMAALQENVVARETE 372          

HSP 2 Score: 97.8265 bits (242), Expect = 1.065e-20
Identity = 53/107 (49.53%), Postives = 67/107 (62.62%), Query Frame = 0
Query:   64 VSRNLYLSPKERKMGSKKRDKNRNGDYTXLLQSRL--YSNDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTGERERRRQ 168
            V R   +S +  +   KK D +       L  SR+   ++D+ H    E RSQCDLLHSM +KMEALY ELAEY+ FDP KY L+EFF+D+KTFKDSF   +E R Q
Sbjct:  153 VDRAARVSMESLQKALKKMDNDIRALEMDLTNSRVPQAADDLFHDTMNEARSQCDLLHSMYKKMEALYSELAEYYCFDPLKYTLDEFFSDIKTFKDSFMFAKEARSQ 259          

HSP 3 Score: 75.0998 bits (183), Expect = 1.163e-12
Identity = 38/83 (45.78%), Postives = 54/83 (65.06%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTSEIGDRSYLITVLVSRNLYLSPKERKMGSKKRDKNR 86
            Q DL HSM +KMEALY ELAEY+ FDP KY L++FF+D+KTFKDSF + + +       +V+R   +  K  K    + +K++
Sbjct:  313 QCDLLHSMYKKMEALYSELAEYYCFDPLKYTLDKFFSDIKTFKDSFMAALQEN------VVARETEVRAKRAKEARAQAEKDK 389          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|509163315|gb|JAA79778.1| (diaphanous [Pararge aegeria])

HSP 1 Score: 94.7449 bits (234), Expect = 6.854e-21
Identity = 42/53 (79.25%), Postives = 46/53 (86.79%), Query Frame = 0
Query:  108 AKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFT 160
            AKE R QCDLLHSM RKMEALY ELAEY+VFDP KY LEEFF+D+KTFKD+F 
Sbjct:   54 AKEAREQCDLLHSMFRKMEALYSELAEYYVFDPHKYTLEEFFSDIKTFKDAFA 106          

HSP 2 Score: 82.0333 bits (201), Expect = 4.539e-16
Identity = 36/48 (75.00%), Postives = 41/48 (85.42%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALY ELAEY+VFDP KY LEEFF+D+KTFKD+F +
Sbjct:   60 QCDLLHSMFRKMEALYSELAEYYVFDPHKYTLEEFFSDIKTFKDAFAT 107          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|910346064|ref|XP_013176923.1| (PREDICTED: protein diaphanous isoform X5 [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 3.908e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  895 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 955          

HSP 2 Score: 85.1149 bits (209), Expect = 4.614e-16
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF +
Sbjct:  908 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 955          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|910346062|ref|XP_013176922.1| (PREDICTED: protein diaphanous isoform X4 [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 3.915e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  912 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 972          

HSP 2 Score: 85.5001 bits (210), Expect = 4.491e-16
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF +
Sbjct:  925 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 972          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|910346058|ref|XP_013176920.1| (PREDICTED: protein diaphanous isoform X2 [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 3.955e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  915 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 975          

HSP 2 Score: 85.5001 bits (210), Expect = 4.407e-16
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF +
Sbjct:  928 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 975          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|910346060|ref|XP_013176921.1| (PREDICTED: protein diaphanous isoform X3 [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 3.992e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  913 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 973          

HSP 2 Score: 85.1149 bits (209), Expect = 4.898e-16
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF +
Sbjct:  926 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 973          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|910346056|ref|XP_013176919.1| (PREDICTED: protein diaphanous isoform X1 [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 3.998e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  927 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 987          

HSP 2 Score: 85.1149 bits (209), Expect = 4.905e-16
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF +
Sbjct:  940 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 987          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|930678450|gb|KPJ18419.1| (Protein diaphanous [Papilio machaon])

HSP 1 Score: 96.6709 bits (239), Expect = 4.149e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  354 NENMASFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAS 414          

HSP 2 Score: 86.2705 bits (212), Expect = 1.667e-16
Identity = 39/48 (81.25%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF S
Sbjct:  367 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAS 414          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|930654077|gb|KPI96412.1| (Protein diaphanous [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 4.210e-20
Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTG 161
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF  
Sbjct:  879 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 939          

HSP 2 Score: 85.5001 bits (210), Expect = 3.689e-16
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF +
Sbjct:  892 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAA 939          
BLAST of OSCA017079-RA vs. genbank:protein
Match: gi|909575725|ref|XP_013143607.1| (PREDICTED: protein diaphanous isoform X3 [Papilio polytes])

HSP 1 Score: 96.6709 bits (239), Expect = 4.748e-20
Identity = 45/60 (75.00%), Postives = 49/60 (81.67%), Query Frame = 0
Query:  101 NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFT 160
            N+   S A E R QCDLLHSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF 
Sbjct:  913 NESMGSFAVEAREQCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFA 972          

HSP 2 Score: 86.2705 bits (212), Expect = 2.022e-16
Identity = 39/48 (81.25%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    4 QSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFTS 51
            Q DL HSM RKMEALYGELAEY+VFDP KY LEEFF+D+KTFKDSF S
Sbjct:  926 QCDLLHSMFRKMEALYGELAEYYVFDPHKYTLEEFFSDIKTFKDSFAS 973          
The following BLAST results are available for this feature:
BLAST of OSCA017079-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914568134|gb|KOB72168.1|2.367e-3549.14putative diaphanous [Operophtera brumata][more]
gi|509163315|gb|JAA79778.1|6.854e-2179.25diaphanous [Pararge aegeria][more]
gi|910346064|ref|XP_013176923.1|3.908e-2073.77PREDICTED: protein diaphanous isoform X5 [Papilio ... [more]
gi|910346062|ref|XP_013176922.1|3.915e-2073.77PREDICTED: protein diaphanous isoform X4 [Papilio ... [more]
gi|910346058|ref|XP_013176920.1|3.955e-2073.77PREDICTED: protein diaphanous isoform X2 [Papilio ... [more]
gi|910346060|ref|XP_013176921.1|3.992e-2073.77PREDICTED: protein diaphanous isoform X3 [Papilio ... [more]
gi|910346056|ref|XP_013176919.1|3.998e-2073.77PREDICTED: protein diaphanous isoform X1 [Papilio ... [more]
gi|930678450|gb|KPJ18419.1|4.149e-2073.77Protein diaphanous [Papilio machaon][more]
gi|930654077|gb|KPI96412.1|4.210e-2073.77Protein diaphanous [Papilio xuthus][more]
gi|909575725|ref|XP_013143607.1|4.748e-2075.00PREDICTED: protein diaphanous isoform X3 [Papilio ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007015 actin filament organization
biological_process GO:0007049 cell cycle
molecular_function GO:0003779 actin binding
molecular_function GO:0017048 Rho GTPase binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015425Formin, FH2 domainPFAMPF02181FH2coord: 107..159
e-value: 3.2E-6
score: 26.1
IPR027658Formin, protein diaphanousPANTHERPTHR23213:SF209PROTEIN DIAPHANOUScoord: 108..175
NoneNo IPR availablePANTHERPTHR23213FORMIN-RELATEDcoord: 108..175
NoneNo IPR availableSUPERFAMILY101447Formin homology 2 domain (FH2 domain)coord: 4..50
NoneNo IPR availableSUPERFAMILY101447Formin homology 2 domain (FH2 domain)coord: 104..173

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25769contignewscf_25769:15..1249 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA017079-RAOSCA017079-RAOstrinia scapulalismRNAnewscf_25769 15..1249 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA017079-PA ID=OSCA017079-PA|Name=OSCA017079-RA|organism=Ostrinia scapulalis|type=polypeptide|length=181bp
MFRQSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFT
SEIGDRSYLITVLVSRNLYLSPKERKMGSKKRDKNRNGDYTXLLQSRLYS
NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFA
DVKTFKDSFTGERERRRQNETEEDIDFQTPL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0017048Rho GTPase binding
GO:0003779actin binding
Vocabulary: Biological Process
TermDefinition
GO:0007015actin filament organization
GO:0007049cell cycle
Vocabulary: INTERPRO
TermDefinition
IPR027658Formin_Dia
IPR015425FH2_Formin