OSCA023841-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA023841-RA
Unique NameOSCA023841-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length72
Homology
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|357621780|gb|EHJ73498.1| (cuticular protein RR-2 motif 91 [Danaus plexippus])

HSP 1 Score: 145.976 bits (367), Expect = 1.195e-43
Identity = 70/72 (97.22%), Postives = 70/72 (97.22%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHK QHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAP HPEYH
Sbjct:   57 AHPKYDYSYSVSDPHTGDHKEQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPVHPEYH 128          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|290560630|ref|NP_001166671.1| (cuticular protein RR-2 motif 91 precursor [Bombyx mori] >gi|223671284|tpd|FAA00594.1| TPA: putative cuticle protein [Bombyx mori])

HSP 1 Score: 145.976 bits (367), Expect = 1.249e-43
Identity = 70/72 (97.22%), Postives = 70/72 (97.22%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAP H EYH
Sbjct:   62 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPAHHEYH 133          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|917954215|ref|NP_001299682.1| (cuticle protein 19-like precursor [Papilio xuthus] >gi|389608349|dbj|BAM17784.1| cuticular protein PxutCPR91 [Papilio xuthus])

HSP 1 Score: 144.821 bits (364), Expect = 2.569e-43
Identity = 69/72 (95.83%), Postives = 71/72 (98.61%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDH+GFNA+VHNTAP HPEYH
Sbjct:   58 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHSGFNAIVHNTAPAHPEYH 129          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|943967183|ref|XP_014365582.1| (PREDICTED: cuticle protein 19-like [Papilio machaon])

HSP 1 Score: 143.28 bits (360), Expect = 1.104e-42
Identity = 68/72 (94.44%), Postives = 70/72 (97.22%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHE RDGDVVKGEYSLLQPDGSFRKVTYTADDH+GFNA+VHNTAP HPEYH
Sbjct:   58 AHPKYDYSYSVSDPHTGDHKTQHEVRDGDVVKGEYSLLQPDGSFRKVTYTADDHSGFNAIVHNTAPAHPEYH 129          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|768432590|ref|XP_011557625.1| (PREDICTED: cuticle protein 19-like [Plutella xylostella] >gi|768443722|ref|XP_011563688.1| PREDICTED: cuticle protein 19-like [Plutella xylostella])

HSP 1 Score: 139.813 bits (351), Expect = 2.160e-41
Identity = 69/72 (95.83%), Postives = 70/72 (97.22%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAP H E+H
Sbjct:   54 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPHH-EFH 124          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|930668755|gb|KPJ09761.1| (Cuticle protein 19 [Papilio machaon])

HSP 1 Score: 146.362 bits (368), Expect = 3.032e-41
Identity = 68/72 (94.44%), Postives = 70/72 (97.22%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHE RDGDVVKGEYSLLQPDGSFRKVTYTADDH+GFNA+VHNTAP HPEYH
Sbjct:  278 AHPKYDYSYSVSDPHTGDHKTQHEVRDGDVVKGEYSLLQPDGSFRKVTYTADDHSGFNAIVHNTAPAHPEYH 349          

HSP 2 Score: 112.464 bits (280), Expect = 2.991e-28
Identity = 49/62 (79.03%), Postives = 59/62 (95.16%), Query Frame = 0
Query:    5 YDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAP 66
            Y++SYSV DPHTGDHK+QHE+R+GDVVKGEYSLLQPDGS R+V Y+ADDH+GFNA+VHN+AP
Sbjct:  109 YEFSYSVEDPHTGDHKSQHESREGDVVKGEYSLLQPDGSVRRVEYSADDHSGFNAIVHNSAP 170          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|930655460|gb|KPI97788.1| (Cuticle protein 19, partial [Papilio xuthus])

HSP 1 Score: 147.132 bits (370), Expect = 3.053e-41
Identity = 69/72 (95.83%), Postives = 71/72 (98.61%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDH+GFNA+VHNTAP HPEYH
Sbjct:  315 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHSGFNAIVHNTAPAHPEYH 386          

HSP 2 Score: 111.694 bits (278), Expect = 8.788e-28
Identity = 49/62 (79.03%), Postives = 59/62 (95.16%), Query Frame = 0
Query:    5 YDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAP 66
            Y++SYSV DPHTGDHK+QHE+R+GDVVKGEYSLLQPDGS R+V Y+ADDH+GFNA+VHN+AP
Sbjct:   95 YEFSYSVEDPHTGDHKSQHESREGDVVKGEYSLLQPDGSVRRVEYSADDHSGFNAIVHNSAP 156          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|909550429|ref|XP_013135027.1| (PREDICTED: cuticle protein-like [Papilio polytes])

HSP 1 Score: 142.51 bits (358), Expect = 1.456e-39
Identity = 68/72 (94.44%), Postives = 69/72 (95.83%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEYH 72
            AHPKYDYSYSVSDPHTGDHKTQHE RDGDVVKGEYSLLQPDGSFRKVTYTADDH+GFNAVVHNTAP H EYH
Sbjct:  310 AHPKYDYSYSVSDPHTGDHKTQHEVRDGDVVKGEYSLLQPDGSFRKVTYTADDHSGFNAVVHNTAPAHHEYH 381          

HSP 2 Score: 108.612 bits (270), Expect = 1.476e-26
Identity = 47/60 (78.33%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    5 YDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNT 64
            Y++SYSV DPHTGDHK+QHE+R+GDVVKGEYSLLQPDGS R+V Y+ADDH+GFNA+VHN+
Sbjct:   96 YEFSYSVEDPHTGDHKSQHESREGDVVKGEYSLLQPDGSVRRVEYSADDHSGFNAIVHNS 155          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|768432586|ref|XP_011557623.1| (PREDICTED: cuticle protein 8-like [Plutella xylostella])

HSP 1 Score: 127.102 bits (318), Expect = 9.527e-36
Identity = 60/71 (84.51%), Postives = 64/71 (90.14%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQHPEY 71
            +HPKY YSYSV DPHTGDHK+QHE+RDGDVVKGEYSLLQPDGSFRKV YTADDHNGFNAVVHN+ P H  Y
Sbjct:   86 SHPKYKYSYSVEDPHTGDHKSQHESRDGDVVKGEYSLLQPDGSFRKVEYTADDHNGFNAVVHNSGPSHHVY 156          
BLAST of OSCA023841-RA vs. genbank:protein
Match: gi|913297121|ref|XP_013187150.1| (PREDICTED: uncharacterized protein LOC106132319 isoform X2 [Amyelois transitella])

HSP 1 Score: 129.028 bits (323), Expect = 1.089e-35
Identity = 60/67 (89.55%), Postives = 63/67 (94.03%), Query Frame = 0
Query:    1 AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNGFNAVVHNTAPQ 67
            AHPKYDYSYSVSDPHTGDHKTQHE RDGDVVKGEYSLLQPDG+FRKVTYTADDHNGFNAVV +  P+
Sbjct:   57 AHPKYDYSYSVSDPHTGDHKTQHEVRDGDVVKGEYSLLQPDGTFRKVTYTADDHNGFNAVVKSFLPE 123          
The following BLAST results are available for this feature:
BLAST of OSCA023841-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357621780|gb|EHJ73498.1|1.195e-4397.22cuticular protein RR-2 motif 91 [Danaus plexippus][more]
gi|290560630|ref|NP_001166671.1|1.249e-4397.22cuticular protein RR-2 motif 91 precursor [Bombyx ... [more]
gi|917954215|ref|NP_001299682.1|2.569e-4395.83cuticle protein 19-like precursor [Papilio xuthus]... [more]
gi|943967183|ref|XP_014365582.1|1.104e-4294.44PREDICTED: cuticle protein 19-like [Papilio machao... [more]
gi|768432590|ref|XP_011557625.1|2.160e-4195.83PREDICTED: cuticle protein 19-like [Plutella xylos... [more]
gi|930668755|gb|KPJ09761.1|3.032e-4194.44Cuticle protein 19 [Papilio machaon][more]
gi|930655460|gb|KPI97788.1|3.053e-4195.83Cuticle protein 19, partial [Papilio xuthus][more]
gi|909550429|ref|XP_013135027.1|1.456e-3994.44PREDICTED: cuticle protein-like [Papilio polytes][more]
gi|768432586|ref|XP_011557623.1|9.527e-3684.51PREDICTED: cuticle protein 8-like [Plutella xylost... [more]
gi|913297121|ref|XP_013187150.1|1.089e-3589.55PREDICTED: uncharacterized protein LOC106132319 is... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0042302 structural constituent of cuticle
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000618Insect cuticle proteinPRINTSPR00947CUTICLEcoord: 42..53
score: 47.68
coord: 31..42
score: 49.32
coord: 3..14
score: 33.33
IPR000618Insect cuticle proteinPFAMPF00379Chitin_bind_4coord: 5..57
e-value: 3.1E-16
score: 59.2
IPR000618Insect cuticle proteinPROSITEPS00233CHIT_BIND_RR_1coord: 33..59
IPR000618Insect cuticle proteinPROSITEPS51155CHIT_BIND_RR_2coord: 2..69
score: 17.453
NoneNo IPR availablePANTHERPTHR12236STRUCTURAL CONTITUENT OF CUTICLEcoord: 1..66
NoneNo IPR availablePANTHERPTHR12236:SF2CUTICULAR PROTEIN 62BCcoord: 1..66

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_18660contignewscf_18660:3068..4466 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA023841-RAOSCA023841-RAOstrinia scapulalismRNAnewscf_18660 3068..4466 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA023841-PA ID=OSCA023841-PA|Name=OSCA023841-RA|organism=Ostrinia scapulalis|type=polypeptide|length=72bp
AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYT
ADDHNGFNAVVHNTAPQHPEYH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0042302structural constituent of cuticle
Vocabulary: INTERPRO
TermDefinition
IPR000618Insect_cuticle