OSCA024044-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA024044-RA
Unique NameOSCA024044-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length120
Homology
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|357610206|gb|EHJ66868.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 108.997 bits (271), Expect = 2.373e-25
Identity = 48/69 (69.57%), Postives = 58/69 (84.06%), Query Frame = 0
Query:   11 RSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAG 79
            R+ +IRRR +VT IA+ I+ +KWQWAGHI +R DGRW RKVLEW+PR G+RS+GRP TRWTDDLVK AG
Sbjct:  455 RNEKIRRRTRVTGIAKRISSLKWQWAGHIHQRTDGRWSRKVLEWKPRIGKRSIGRPPTRWTDDLVKAAG 523          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 108.997 bits (271), Expect = 3.037e-25
Identity = 49/61 (80.33%), Postives = 54/61 (88.52%), Query Frame = 0
Query:   20 KVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            KV DIAR I+++KWQWAGHIARR DGRWGRK+LEWRPR G+RSVGRP TRWTDDLVK AG 
Sbjct:  906 KVADIARRISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGS 966          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|298204329|gb|ADI61813.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 107.071 bits (266), Expect = 1.434e-24
Identity = 52/80 (65.00%), Postives = 61/80 (76.25%), Query Frame = 0
Query:    1 MGLIRRLKVRRSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            +G+  R K+R   EIRRR KV DIA   +++KWQWAGHI R +D RWGRKV+EWRPR G RSVGRP TRWTDDLV+ AG 
Sbjct:  882 LGISLRDKIRNE-EIRRRTKVDDIALKASRLKWQWAGHICRDSDARWGRKVIEWRPRMGTRSVGRPPTRWTDDLVRTAGS 960          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 100.138 bits (248), Expect = 1.854e-24
Identity = 53/98 (54.08%), Postives = 68/98 (69.39%), Query Frame = 0
Query:    1 MGLIRRLKV-RRSIEIRRRI------------------KVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAG 79
            +GL+ RL V +R++E++R +                  KVTD+A  ++K+KWQWAGHIARR DGRW R+VLEWRPR G+RSVGRP  RWTDD+VK AG
Sbjct:   35 LGLLNRLGVTQRAMEMKRAMPGVSLRDRIRNEEIRRRTKVTDMAYRVSKLKWQWAGHIARRTDGRWSRRVLEWRPRTGKRSVGRPPARWTDDIVKSAG 132          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|827560966|ref|XP_012551328.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101744003 [Bombyx mori])

HSP 1 Score: 106.301 bits (264), Expect = 2.085e-24
Identity = 48/61 (78.69%), Postives = 54/61 (88.52%), Query Frame = 0
Query:   20 KVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            KV DIAR ++++KWQWAGHIARR DGRWGRK+LEWRPR G+RSVGRP TRWTDDLVK AG 
Sbjct:  419 KVADIARRLSELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGS 479          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|825740729|ref|WP_047149332.1| (hypothetical protein [Escherichia coli])

HSP 1 Score: 105.916 bits (263), Expect = 2.835e-24
Identity = 56/97 (57.73%), Postives = 66/97 (68.04%), Query Frame = 0
Query:    1 MGLIRRLKV-RRSIE----------------IRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            +GL+ R KV +R++E                IR+R KVTDIA  I K+KWQWAGHI RR D RWGR+VLEWRPR G+RSVGRP  RWTDDL +VAG 
Sbjct:  494 VGLVHRFKVAQRAMERAMLGVSLMDRIRNEVIRQRTKVTDIAVKICKLKWQWAGHICRRTDNRWGRRVLEWRPRTGKRSVGRPPARWTDDLRRVAGS 590          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|357602779|gb|EHJ63510.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 97.4413 bits (241), Expect = 4.677e-24
Identity = 47/70 (67.14%), Postives = 56/70 (80.00%), Query Frame = 0
Query:   11 RSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            R+ +I RR++VTDIA+ I+ +KWQWAG IAR  D RWGRKVLEWRP  G+R +GRP TRWTDDLVK AG 
Sbjct:   25 RNYKICRRMRVTDIAKRISSLKWQWAGDIARETDSRWGRKVLEWRPPIGKRRIGRPPTRWTDDLVKAAGS 94          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|357613666|gb|EHJ68642.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 103.605 bits (257), Expect = 6.511e-24
Identity = 50/67 (74.63%), Postives = 55/67 (82.09%), Query Frame = 0
Query:   14 EIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            EIRRR +V+DIA+ I+  KWQWA HIARR DGRWGRKVLE RPR G+RS GRP TRWTDDLVK AG 
Sbjct:  322 EIRRRTRVSDIAKQISYWKWQWADHIARRKDGRWGRKVLESRPRIGKRSDGRPPTRWTDDLVKAAGS 388          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|298204341|gb|ADI61819.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 105.145 bits (261), Expect = 7.322e-24
Identity = 51/79 (64.56%), Postives = 61/79 (77.22%), Query Frame = 0
Query:    1 MGLIRRLKVRRSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAG 79
            + L+ RL   R+ EIR+R KVTDIA  I+K+KWQWAGH  RR DGRW R+VL+WRPR G+RSVGRP  RWTDDL + AG
Sbjct:  886 VSLMDRL---RNEEIRQRTKVTDIALKISKLKWQWAGHTCRRTDGRWSRRVLDWRPRTGKRSVGRPPARWTDDLRRYAG 961          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|827540150|ref|XP_012553149.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101739909, partial [Bombyx mori])

HSP 1 Score: 102.834 bits (255), Expect = 9.868e-24
Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 0
Query:   20 KVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            KVTDIAR I+ +KWQWAGHIARR+D RWG K+LEWRPR G+RSVGRP TRWTDDLV+ AG 
Sbjct:  293 KVTDIARRISTLKWQWAGHIARRSDCRWGGKILEWRPRTGKRSVGRPPTRWTDDLVRTAGS 353          
The following BLAST results are available for this feature:
BLAST of OSCA024044-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357610206|gb|EHJ66868.1|2.373e-2569.57endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204325|gb|ADI61811.1|3.037e-2580.33endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204329|gb|ADI61813.1|1.434e-2465.00endonuclease-reverse transcriptase [Bombyx mori][more]
gi|825740785|ref|WP_047149388.1|1.854e-2454.08hypothetical protein, partial [Escherichia coli][more]
gi|827560966|ref|XP_012551328.1|2.085e-2478.69PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|825740729|ref|WP_047149332.1|2.835e-2457.73hypothetical protein [Escherichia coli][more]
gi|357602779|gb|EHJ63510.1|4.677e-2467.14endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357613666|gb|EHJ68642.1|6.511e-2474.63endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204341|gb|ADI61819.1|7.322e-2464.56endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827540150|ref|XP_012553149.1|9.868e-2477.05PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25216contignewscf_25216:1513..1926 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA024044-RAOSCA024044-RAOstrinia scapulalismRNAnewscf_25216 1513..1926 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA024044-PA ID=OSCA024044-PA|Name=OSCA024044-RA|organism=Ostrinia scapulalis|type=polypeptide|length=120bp
MGLIRRLKVRRSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRK
VLEWRPRAGRRSVGRPFTRWTDDLVKVAGGAGPVFMENLGGGLCPAVDVF
RLKRTNERTNVINANVGEDR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity