OSCA024835-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA024835-RA
Unique NameOSCA024835-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length30
Homology
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|930678883|gb|KPJ18804.1| (hypothetical protein RR48_02587 [Papilio machaon])

HSP 1 Score: 56.9954 bits (136), Expect = 3.272e-10
Identity = 27/30 (90.00%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILSVDETIKN K EAPPQMPGRGMGRP MG
Sbjct:   23 ILSVDETIKNVKSEAPPQMPGRGMGRPMMG 52          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|943938974|ref|XP_014371155.1| (PREDICTED: T-complex protein 1 subunit eta [Papilio machaon])

HSP 1 Score: 59.3066 bits (142), Expect = 1.996e-9
Identity = 27/30 (90.00%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILSVDETIKN K EAPPQMPGRGMGRP MG
Sbjct:  425 ILSVDETIKNVKSEAPPQMPGRGMGRPMMG 454          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|930678882|gb|KPJ18803.1| (T-complex protein 1 subunit eta [Papilio machaon])

HSP 1 Score: 59.3066 bits (142), Expect = 2.220e-9
Identity = 27/30 (90.00%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILSVDETIKN K EAPPQMPGRGMGRP MG
Sbjct:  451 ILSVDETIKNVKSEAPPQMPGRGMGRPMMG 480          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|910341464|ref|XP_013174443.1| (PREDICTED: T-complex protein 1 subunit eta isoform X2 [Papilio xuthus])

HSP 1 Score: 58.9214 bits (141), Expect = 2.770e-9
Identity = 26/30 (86.67%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILS+DETIKN K EAPPQMPGRGMGRP MG
Sbjct:  513 ILSIDETIKNVKSEAPPQMPGRGMGRPMMG 542          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|930663124|gb|KPJ04730.1| (T-complex protein 1 subunit eta [Papilio xuthus])

HSP 1 Score: 58.5362 bits (140), Expect = 3.143e-9
Identity = 26/30 (86.67%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILS+DETIKN K EAPPQMPGRGMGRP MG
Sbjct:  528 ILSIDETIKNVKSEAPPQMPGRGMGRPMMG 557          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|910341462|ref|XP_013174442.1| (PREDICTED: T-complex protein 1 subunit eta isoform X1 [Papilio xuthus])

HSP 1 Score: 58.5362 bits (140), Expect = 3.144e-9
Identity = 26/30 (86.67%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILS+DETIKN K EAPPQMPGRGMGRP MG
Sbjct:  521 ILSIDETIKNVKSEAPPQMPGRGMGRPMMG 550          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|909561407|ref|XP_013135832.1| (PREDICTED: T-complex protein 1 subunit eta [Papilio polytes])

HSP 1 Score: 58.5362 bits (140), Expect = 3.678e-9
Identity = 26/30 (86.67%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILS+DETIKN K EAPPQMPGRGMGRP MG
Sbjct:  361 ILSIDETIKNVKSEAPPQMPGRGMGRPMMG 390          
BLAST of OSCA024835-RA vs. genbank:protein
Match: gi|389610251|dbj|BAM18737.1| (chaperonin [Papilio xuthus])

HSP 1 Score: 58.151 bits (139), Expect = 3.980e-9
Identity = 26/30 (86.67%), Postives = 27/30 (90.00%), Query Frame = 0
Query:    1 ILSVDETIKNAKGEAPPQMPGRGMGRPRMG 30
            ILS+DETIKN K EAPPQMPGRGMGRP MG
Sbjct:  222 ILSIDETIKNVKSEAPPQMPGRGMGRPMMG 251          
The following BLAST results are available for this feature:
BLAST of OSCA024835-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 8
Match NameE-valueIdentityDescription
gi|930678883|gb|KPJ18804.1|3.272e-1090.00hypothetical protein RR48_02587 [Papilio machaon][more]
gi|943938974|ref|XP_014371155.1|1.996e-990.00PREDICTED: T-complex protein 1 subunit eta [Papili... [more]
gi|930678882|gb|KPJ18803.1|2.220e-990.00T-complex protein 1 subunit eta [Papilio machaon][more]
gi|910341464|ref|XP_013174443.1|2.770e-986.67PREDICTED: T-complex protein 1 subunit eta isoform... [more]
gi|930663124|gb|KPJ04730.1|3.143e-986.67T-complex protein 1 subunit eta [Papilio xuthus][more]
gi|910341462|ref|XP_013174442.1|3.144e-986.67PREDICTED: T-complex protein 1 subunit eta isoform... [more]
gi|909561407|ref|XP_013135832.1|3.678e-986.67PREDICTED: T-complex protein 1 subunit eta [Papili... [more]
gi|389610251|dbj|BAM18737.1|3.980e-986.67chaperonin [Papilio xuthus][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25311contignewscf_25311:754..846 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA024835-RAOSCA024835-RAOstrinia scapulalismRNAnewscf_25311 754..846 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA024835-PA ID=OSCA024835-PA|Name=OSCA024835-RA|organism=Ostrinia scapulalis|type=polypeptide|length=30bp
ILSVDETIKNAKGEAPPQMPGRGMGRPRMG
back to top