OSCA025848-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025848-RA
Unique NameOSCA025848-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length55
Homology
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 68.9366 bits (167), Expect = 2.378e-12
Identity = 35/60 (58.33%), Postives = 40/60 (66.67%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPAIVE-----IIGEAYVQQWTSYG 55
            K+LEW PRTGKRSVG PPT WTDDL+K     SR     ++      IGEAYVQQWT+ G
Sbjct:  936 KILEWRPRTGKRSVGRPPTRWTDDLVKSA--GSRWMQVAMDRSHWKSIGEAYVQQWTAIG 993          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|930681026|gb|KPJ20566.1| (hypothetical protein RR46_00054, partial [Papilio xuthus])

HSP 1 Score: 62.7734 bits (151), Expect = 6.149e-12
Identity = 33/59 (55.93%), Postives = 40/59 (67.80%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPAIVEI----IGEAYVQQWTSYG 55
            KVLEW PRTG+RSVG PP  WTDDL+ K+  A+  Q A   +    +GEAY QQW +YG
Sbjct:    8 KVLEWRPRTGRRSVGRPPARWTDDLV-KITGATWMQLAQDRLSWRSLGEAYAQQWVTYG 65          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 65.0846 bits (157), Expect = 7.039e-12
Identity = 34/61 (55.74%), Postives = 40/61 (65.57%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPAIV------EIIGEAYVQQWTSYG 55
            +VLEW PRTGKRSVG PP  WTDD++K    A +H           + +GEAYVQQWTSYG
Sbjct:  103 RVLEWRPRTGKRSVGRPPARWTDDIVK---SAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 67.3958 bits (163), Expect = 8.726e-12
Identity = 34/59 (57.63%), Postives = 43/59 (72.88%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPA----IVEIIGEAYVQQWTSYG 55
            KVLEW PR G+RSVG PPT WTDDL+ KV  ++  Q A    + + +GEA+VQQWTS+G
Sbjct:  440 KVLEWRPRAGRRSVGRPPTRWTDDLV-KVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 67.3958 bits (163), Expect = 9.699e-12
Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIK----KVLDASRHQPAIVEIIGEAYVQQWTSYG 55
            KVLEW PRTG+RSVG PPT W DDL++    + + A++ + ++   +GEAYVQQWTS G
Sbjct:  932 KVLEWRPRTGRRSVGRPPTRWADDLLRFAGIRWMQAAQDR-SLWRGLGEAYVQQWTSMG 989          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 62.3882 bits (150), Expect = 1.018e-11
Identity = 35/59 (59.32%), Postives = 40/59 (67.80%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPA----IVEIIGEAYVQQWTSYG 55
            KVLEW PRTG+RSVG PP  WTDDL+ KV  AS  + A        +GEAYVQQW S+G
Sbjct:    8 KVLEWRPRTGRRSVGRPPARWTDDLV-KVAGASWMRVAQDRSSWRSLGEAYVQQWASHG 65          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 66.2402 bits (160), Expect = 2.268e-11
Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIK----KVLDASRHQPAIVEIIGEAYVQQWT 52
            K+LEW PRTGKRSVG PPT WTDDL+K      +  +  +P     +GEAYVQQWT
Sbjct:  936 KILEWRPRTGKRSVGRPPTRWTDDLVKISGSHWMQVATDRPHWTS-VGEAYVQQWT 990          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 65.855 bits (159), Expect = 3.106e-11
Identity = 34/59 (57.63%), Postives = 43/59 (72.88%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPA----IVEIIGEAYVQQWTSYG 55
            KVLEW PR G+RSVG PPT WTDDL+ KV  ++  Q A    + + +GEA+VQQWTS+G
Sbjct:  306 KVLEWRPRAGRRSVGRPPTRWTDDLV-KVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 65.4698 bits (158), Expect = 3.844e-11
Identity = 32/59 (54.24%), Postives = 44/59 (74.58%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKV----LDASRHQPAIVEIIGEAYVQQWTSYG 55
            KVLEW PR G+RSVG PPT WTDDL+K      + A++ + ++ + +GEA+VQQWTS+G
Sbjct:  421 KVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDR-SLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA025848-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 65.0846 bits (157), Expect = 5.451e-11
Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 0
Query:    1 KVLEWSPRTGKRSVGCPPTSWTDDLIKKV----LDASRHQPAIVEIIGEAYVQQWTSYG 55
            +VLEW PR G+RSVG PP  WTDDL+K      + A++ + A+ + +GEAYVQQWT+YG
Sbjct:  713 RVLEWRPRIGRRSVGRPPARWTDDLVKVAGAHWMRAAQDR-ALWQSMGEAYVQQWTTYG 770          
The following BLAST results are available for this feature:
BLAST of OSCA025848-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|298204325|gb|ADI61811.1|2.378e-1258.33endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930681026|gb|KPJ20566.1|6.149e-1255.93hypothetical protein RR46_00054, partial [Papilio ... [more]
gi|825740785|ref|WP_047149388.1|7.039e-1255.74hypothetical protein, partial [Escherichia coli][more]
gi|134001323|gb|ABO45239.1|8.726e-1257.63reverse transcriptase [Ostrinia nubilalis][more]
gi|298204337|gb|ADI61817.1|9.699e-1254.24endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930681186|gb|KPJ20726.1|1.018e-1159.32hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|298204327|gb|ADI61812.1|2.268e-1157.14endonuclease-reverse transcriptase [Bombyx mori][more]
gi|134001247|gb|ABO45233.1|3.106e-1157.63reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001215|gb|ABO45231.1|3.844e-1154.24reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|909577882|ref|XP_013144778.1|5.451e-1154.24PREDICTED: uncharacterized protein LOC106108224 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
molecular_function GO:0003824 catalytic activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_17074contignewscf_17074:495..662 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025848-RAOSCA025848-RAOstrinia scapulalismRNAnewscf_17074 495..662 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025848-PA ID=OSCA025848-PA|Name=OSCA025848-RA|organism=Ostrinia scapulalis|type=polypeptide|length=55bp
KVLEWSPRTGKRSVGCPPTSWTDDLIKKVLDASRHQPAIVEIIGEAYVQQ
WTSYG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process