OSCA025849-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025849-RA
Unique NameOSCA025849-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length62
Homology
BLAST of OSCA025849-RA vs. genbank:protein
Match: gi|298204359|gb|ADI61828.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 69.3218 bits (168), Expect = 2.574e-12
Identity = 29/50 (58.00%), Postives = 41/50 (82.00%), Query Frame = 0
Query:    2 GEVEGTRSRGRSPMHWTDQVKSAVGDGVCDCTRQSANRERWQEIVRRVVS 51
            G V+GTR RGR PM WTDQ+K+AVG  + +C+R +++RERW++IVRR+ S
Sbjct:  956 GSVDGTRPRGRPPMRWTDQIKTAVGGPLNECSRMASSRERWRDIVRRIKS 1005          
BLAST of OSCA025849-RA vs. genbank:protein
Match: gi|930679191|gb|KPJ19108.1| (hypothetical protein RR48_12619 [Papilio machaon])

HSP 1 Score: 60.077 bits (144), Expect = 1.185e-10
Identity = 24/49 (48.98%), Postives = 38/49 (77.55%), Query Frame = 0
Query:    1 NGEVEGTRSRGRSPMHWTDQVKSAVGDGVCDCTRQSANRERWQEIVRRV 49
             G++EGTR RGRSPM W DQ+++AV   + +CT+++ +RE W+ +V+RV
Sbjct:   22 QGKLEGTRPRGRSPMRWADQIRAAVAVPLHECTKKAESREEWRRLVQRV 70          
BLAST of OSCA025849-RA vs. genbank:protein
Match: gi|930650527|gb|KPI92872.1| (hypothetical protein RR46_14093 [Papilio xuthus])

HSP 1 Score: 56.6102 bits (135), Expect = 5.393e-9
Identity = 25/49 (51.02%), Postives = 36/49 (73.47%), Query Frame = 0
Query:    1 NGEVEGTRSRGRSPMHWTDQVKSAVGDGVCDCTRQSANRERWQEIVRRV 49
             G+VEG R RGRSPM  TDQ+++AV   +  CT+++A RE W+ +V+RV
Sbjct:   54 QGKVEGNRPRGRSPMRRTDQIRAAVDVPLHQCTKKAATREEWRRLVKRV 102          
BLAST of OSCA025849-RA vs. genbank:protein
Match: gi|298204343|gb|ADI61820.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 59.6918 bits (143), Expect = 6.003e-9
Identity = 26/52 (50.00%), Postives = 38/52 (73.08%), Query Frame = 0
Query:    2 GEVEGTRSRGRSPMHWTDQVKSAVGDGVCDCTRQSANRERWQEIVRRVVSAS 53
            G +EGTR R RSP+ WTDQ+K+A+   V +CTR++A RE W+ +V+R  + S
Sbjct:  950 GMIEGTRPRRRSPLRWTDQIKAALNGPVNECTRRAAVREEWRRLVKRTTNRS 1001          
The following BLAST results are available for this feature:
BLAST of OSCA025849-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 4
Match NameE-valueIdentityDescription
gi|298204359|gb|ADI61828.1|2.574e-1258.00endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930679191|gb|KPJ19108.1|1.185e-1048.98hypothetical protein RR48_12619 [Papilio machaon][more]
gi|930650527|gb|KPI92872.1|5.393e-951.02hypothetical protein RR46_14093 [Papilio xuthus][more]
gi|298204343|gb|ADI61820.1|6.003e-950.00endonuclease-reverse transcriptase [Bombyx mori][more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_24305contignewscf_24305:1814..2002 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025849-RAOSCA025849-RAOstrinia scapulalismRNAnewscf_24305 1814..2002 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025849-PA ID=OSCA025849-PA|Name=OSCA025849-RA|organism=Ostrinia scapulalis|type=polypeptide|length=62bp
NGEVEGTRSRGRSPMHWTDQVKSAVGDGVCDCTRQSANRERWQEIVRRVV
SASTTDLNNAST
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity