OSCA025851-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025851-RA
Unique NameOSCA025851-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length138
Homology
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|357612573|gb|EHJ68068.1| (hypothetical protein KGM_01230 [Danaus plexippus])

HSP 1 Score: 96.2857 bits (238), Expect = 2.894e-21
Identity = 47/57 (82.46%), Postives = 49/57 (85.96%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGD-SLQGAEEYAA 56
            MKKFLRNIDKHKNEQ SKS+EKAISKLTTMRGILKDGRC PECTGD S+   E Y A
Sbjct:  191 MKKFLRNIDKHKNEQMSKSTEKAISKLTTMRGILKDGRCGPECTGDSSIHDTEGYNA 247          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|512928397|ref|XP_004931568.1| (PREDICTED: uncharacterized protein LOC101738357 [Bombyx mori])

HSP 1 Score: 92.4337 bits (228), Expect = 9.159e-20
Identity = 45/63 (71.43%), Postives = 50/63 (79.37%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGD-SLQGAEEYAAGVLRMY 62
            MKKFLRN+DKHK +Q  KSSEKA+SKLTTMRGILKDGRC PECTGD S+QG EE+       Y
Sbjct:  195 MKKFLRNMDKHKCDQYMKSSEKAVSKLTTMRGILKDGRCGPECTGDSSVQGVEEFNDEATLQY 257          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|913318822|ref|XP_013190458.1| (PREDICTED: uncharacterized protein LOC106134862 [Amyelois transitella])

HSP 1 Score: 89.7373 bits (221), Expect = 1.091e-18
Identity = 46/55 (83.64%), Postives = 47/55 (85.45%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDS-LQGAEEY 54
            MKK LRNIDKHK+E  SK  EKAISKLTTMRGILKDGRCVPECTGDS  QG EEY
Sbjct:  216 MKKLLRNIDKHKSEM-SKVGEKAISKLTTMRGILKDGRCVPECTGDSTAQGHEEY 269          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|910337016|ref|XP_013172065.1| (PREDICTED: uncharacterized protein LOC106121111 [Papilio xuthus] >gi|930654920|gb|KPI97252.1| hypothetical protein RR46_09159 [Papilio xuthus])

HSP 1 Score: 86.6557 bits (213), Expect = 1.164e-17
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDS-LQGAEEYAAG 57
            MKK LRNIDKHK EQNSKS+EKAISKLTTMRGILKD RC  ECTGDS    +++Y A 
Sbjct:  198 MKKLLRNIDKHKVEQNSKSNEKAISKLTTMRGILKDNRCDLECTGDSTAHDSDDYNAA 255          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|909581602|ref|XP_013146795.1| (PREDICTED: uncharacterized protein LOC106109740 [Papilio polytes])

HSP 1 Score: 86.6557 bits (213), Expect = 1.317e-17
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDS-LQGAEEYAAG 57
            MKK LRNIDKHK EQNSKS+EKAISKLTTMRGILKD RC  ECTGDS    +++Y A 
Sbjct:  199 MKKLLRNIDKHKVEQNSKSNEKAISKLTTMRGILKDNRCDLECTGDSTAHDSDDYNAA 256          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|914572921|gb|KOB75631.1| (Seminal fluid protein [Operophtera brumata])

HSP 1 Score: 84.3445 bits (207), Expect = 6.273e-17
Identity = 38/45 (84.44%), Postives = 41/45 (91.11%), Query Frame = 0
Query:   11 HKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDSLQGAEEYA 55
            HKNEQNSK SEKAISKLTTMRGILKDGRC PECTGDS+Q  E+Y+
Sbjct:  171 HKNEQNSKLSEKAISKLTTMRGILKDGRCGPECTGDSVQETEDYS 215          

HSP 2 Score: 62.7734 bits (151), Expect = 5.468e-9
Identity = 27/42 (64.29%), Postives = 33/42 (78.57%), Query Frame = 0
Query:   71 SSEVVTKLTTMRGILKDGRCVPECTGDSVQGAEEYTASVLRM 112
            S + ++KLTTMRGILKDGRC PECTGDSVQ  E+Y+   L +
Sbjct:  180 SEKAISKLTTMRGILKDGRCGPECTGDSVQETEDYSMEDLTL 221          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|943975478|ref|XP_014368932.1| (PREDICTED: uncharacterized protein LOC106719174 isoform X2 [Papilio machaon])

HSP 1 Score: 84.7297 bits (208), Expect = 6.632e-17
Identity = 42/58 (72.41%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDS-LQGAEEYAAG 57
            MKK LRNIDKHK EQNSKS+EKAISKLTT+RGILKD RC  ECTGDS    +++Y A 
Sbjct:  185 MKKLLRNIDKHKVEQNSKSNEKAISKLTTVRGILKDNRCDLECTGDSTTHDSDDYNAA 242          
BLAST of OSCA025851-RA vs. genbank:protein
Match: gi|943975475|ref|XP_014368931.1| (PREDICTED: uncharacterized protein LOC106719174 isoform X1 [Papilio machaon] >gi|930666169|gb|KPJ07292.1| hypothetical protein RR48_07708 [Papilio machaon])

HSP 1 Score: 84.3445 bits (207), Expect = 9.386e-17
Identity = 42/58 (72.41%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDS-LQGAEEYAAG 57
            MKK LRNIDKHK EQNSKS+EKAISKLTT+RGILKD RC  ECTGDS    +++Y A 
Sbjct:  199 MKKLLRNIDKHKVEQNSKSNEKAISKLTTVRGILKDNRCDLECTGDSTTHDSDDYNAA 256          
The following BLAST results are available for this feature:
BLAST of OSCA025851-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 8
Match NameE-valueIdentityDescription
gi|357612573|gb|EHJ68068.1|2.894e-2182.46hypothetical protein KGM_01230 [Danaus plexippus][more]
gi|512928397|ref|XP_004931568.1|9.159e-2071.43PREDICTED: uncharacterized protein LOC101738357 [B... [more]
gi|913318822|ref|XP_013190458.1|1.091e-1883.64PREDICTED: uncharacterized protein LOC106134862 [A... [more]
gi|910337016|ref|XP_013172065.1|1.164e-1774.14PREDICTED: uncharacterized protein LOC106121111 [P... [more]
gi|909581602|ref|XP_013146795.1|1.317e-1774.14PREDICTED: uncharacterized protein LOC106109740 [P... [more]
gi|914572921|gb|KOB75631.1|6.273e-1784.44Seminal fluid protein [Operophtera brumata][more]
gi|943975478|ref|XP_014368932.1|6.632e-1772.41PREDICTED: uncharacterized protein LOC106719174 is... [more]
gi|943975475|ref|XP_014368931.1|9.386e-1772.41PREDICTED: uncharacterized protein LOC106719174 is... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_22810contignewscf_22810:122..538 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025851-RAOSCA025851-RAOstrinia scapulalismRNAnewscf_22810 122..538 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025851-PA ID=OSCA025851-PA|Name=OSCA025851-RA|organism=Ostrinia scapulalis|type=polypeptide|length=138bp
MKKFLRNIDKHKNEQNSKSSEKAISKLTTMRGILKDGRCVPECTGDSLQG
AEEYAAGVLRMYSSILITIASSEVVTKLTTMRGILKDGRCVPECTGDSVQ
GAEEYTASVLRMYSSVLITIASSKIVTKLTTMRGILVP
back to top