OSCA025852-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025852-RA
Unique NameOSCA025852-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length54
Homology
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|913303344|ref|XP_013200751.1| (PREDICTED: CTP synthase [Amyelois transitella])

HSP 1 Score: 118.627 bits (296), Expect = 6.733e-30
Identity = 53/54 (98.15%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLK ANSTEVDPNCEDK
Sbjct:  383 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKAANSTEVDPNCEDK 436          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|909567256|ref|XP_013139031.1| (PREDICTED: CTP synthase [Papilio polytes])

HSP 1 Score: 118.627 bits (296), Expect = 7.030e-30
Identity = 53/54 (98.15%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKIEA QWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK
Sbjct:  382 MEGKIEAAQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 435          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|512903631|ref|XP_004925667.1| (PREDICTED: CTP synthase [Bombyx mori])

HSP 1 Score: 118.242 bits (295), Expect = 9.129e-30
Identity = 53/54 (98.15%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDP CEDK
Sbjct:  382 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPACEDK 435          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|914570921|gb|KOB74172.1| (CTP synthase, partial [Operophtera brumata])

HSP 1 Score: 117.087 bits (292), Expect = 1.289e-29
Identity = 51/54 (94.44%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKIEACQWCRETQ+PMLGICLGLQAAVIEF+RNVLGLKGANSTEVDP CEDK
Sbjct:  363 MEGKIEACQWCRETQRPMLGICLGLQAAVIEFSRNVLGLKGANSTEVDPQCEDK 416          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|910312947|ref|XP_013172254.1| (PREDICTED: CTP synthase [Papilio xuthus] >gi|930664199|gb|KPJ05607.1| CTP synthase [Papilio xuthus])

HSP 1 Score: 117.472 bits (293), Expect = 1.571e-29
Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKIEA QWCRETQKPMLGICLGLQAAVIEFARNVLGLKGAN+TEVDPNCEDK
Sbjct:  382 MEGKIEAAQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANTTEVDPNCEDK 435          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|943978616|ref|XP_014370259.1| (PREDICTED: CTP synthase [Papilio machaon] >gi|930664918|gb|KPJ06049.1| CTP synthase [Papilio machaon])

HSP 1 Score: 117.472 bits (293), Expect = 1.667e-29
Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKIEA QWCRETQKPMLGICLGLQAAVIEFARNVLGLKGAN+TEVDPNCEDK
Sbjct:  382 MEGKIEAAQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANTTEVDPNCEDK 435          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|357625181|gb|EHJ75708.1| (CTP synthase [Danaus plexippus])

HSP 1 Score: 112.464 bits (280), Expect = 9.353e-28
Identity = 49/54 (90.74%), Postives = 53/54 (98.15%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            +EGKIEAC+WCRETQKPML ICLGLQAAVIEFARNVLGLKGANSTEV+P+CEDK
Sbjct:  379 LEGKIEACRWCRETQKPMLAICLGLQAAVIEFARNVLGLKGANSTEVNPDCEDK 432          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|509178261|gb|JAA87251.1| (CTP synthase, partial [Pararge aegeria])

HSP 1 Score: 108.997 bits (271), Expect = 1.586e-27
Identity = 50/54 (92.59%), Postives = 54/54 (100.00%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            +EGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEV+P+C+DK
Sbjct:  239 IEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVNPDCDDK 292          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|768438734|ref|XP_011560965.1| (PREDICTED: CTP synthase [Plutella xylostella])

HSP 1 Score: 110.153 bits (274), Expect = 7.911e-27
Identity = 48/54 (88.89%), Postives = 52/54 (96.30%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKI ACQWCRETQKPMLGICLGLQAAV+EFARNVL LKGA++TEVDPNC+DK
Sbjct:  382 MEGKILACQWCRETQKPMLGICLGLQAAVVEFARNVLDLKGAHTTEVDPNCDDK 435          
BLAST of OSCA025852-RA vs. genbank:protein
Match: gi|768418769|ref|XP_011550084.1| (PREDICTED: CTP synthase-like [Plutella xylostella])

HSP 1 Score: 109.768 bits (273), Expect = 8.942e-27
Identity = 48/54 (88.89%), Postives = 52/54 (96.30%), Query Frame = 0
Query:    1 MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPNCEDK 54
            MEGKI ACQWCRETQKPMLGICLGLQAAV+EFARNVL LKGA++TEVDPNC+DK
Sbjct:  379 MEGKILACQWCRETQKPMLGICLGLQAAVVEFARNVLDLKGAHTTEVDPNCDDK 432          
The following BLAST results are available for this feature:
BLAST of OSCA025852-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913303344|ref|XP_013200751.1|6.733e-3098.15PREDICTED: CTP synthase [Amyelois transitella][more]
gi|909567256|ref|XP_013139031.1|7.030e-3098.15PREDICTED: CTP synthase [Papilio polytes][more]
gi|512903631|ref|XP_004925667.1|9.129e-3098.15PREDICTED: CTP synthase [Bombyx mori][more]
gi|914570921|gb|KOB74172.1|1.289e-2994.44CTP synthase, partial [Operophtera brumata][more]
gi|910312947|ref|XP_013172254.1|1.571e-2996.30PREDICTED: CTP synthase [Papilio xuthus] >gi|93066... [more]
gi|943978616|ref|XP_014370259.1|1.667e-2996.30PREDICTED: CTP synthase [Papilio machaon] >gi|9306... [more]
gi|357625181|gb|EHJ75708.1|9.353e-2890.74CTP synthase [Danaus plexippus][more]
gi|509178261|gb|JAA87251.1|1.586e-2792.59CTP synthase, partial [Pararge aegeria][more]
gi|768438734|ref|XP_011560965.1|7.911e-2788.89PREDICTED: CTP synthase [Plutella xylostella][more]
gi|768418769|ref|XP_011550084.1|8.942e-2788.89PREDICTED: CTP synthase-like [Plutella xylostella][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0044210 'de novo' CTP biosynthetic process
biological_process GO:0006541 glutamine metabolic process
biological_process GO:0006221 pyrimidine nucleotide biosynthetic process
molecular_function GO:0005524 ATP binding
molecular_function GO:0003883 CTP synthase activity
molecular_function GO:0003677 DNA binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017926Glutamine amidotransferasePFAMPF00117GATasecoord: 2..39
e-value: 3.7E-12
score: 45.9
IPR017926Glutamine amidotransferasePROSITEPS51273GATASE_TYPE_1coord: 1..54
score: 10.283
IPR029062Class I glutamine amidotransferase-likeGENE3D3.40.50.880coord: 2..53
e-value: 1.7E-21
score: 76.2
IPR029062Class I glutamine amidotransferase-likeSUPERFAMILY52317Class I glutamine amidotransferase-likecoord: 2..52
NoneNo IPR availablePANTHERPTHR11550:SF0CTP SYNTHASE 1-RELATEDcoord: 1..54
IPR004468CTP synthasePANTHERPTHR11550CTP SYNTHASEcoord: 1..54

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_16367contignewscf_16367:1..162 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025852-RAOSCA025852-RAOstrinia scapulalismRNAnewscf_16367 1..162 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025852-PA ID=OSCA025852-PA|Name=OSCA025852-RA|organism=Ostrinia scapulalis|type=polypeptide|length=54bp
MEGKIEACQWCRETQKPMLGICLGLQAAVIEFARNVLGLKGANSTEVDPN
CEDK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0044210'de novo' CTP biosynthetic process
GO:0006541glutamine metabolic process
GO:0006221pyrimidine nucleotide biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0003883CTP synthase activity
Vocabulary: INTERPRO
TermDefinition
IPR004468CTP_synthase
IPR029062Class_I_gatase-like
IPR017926GATASE