OSCA025853-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025853-RA
Unique NameOSCA025853-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length85
Homology
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 93.2041 bits (230), Expect = 1.089e-20
Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKV 48
            KIKWQWAGHIARRADGRWGRK LEW+PRAGRRSVGRP TRW+DDLVKV
Sbjct:  286 KIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKV 333          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 93.5893 bits (231), Expect = 1.483e-20
Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKV 48
            KIKWQWAGHIARRADGRWGRK LEW+PRAGRRSVGRP TRW+DDLVKV
Sbjct:  420 KIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKV 467          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 93.5893 bits (231), Expect = 1.641e-20
Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKV 48
            KIKWQWAGHIARRADGRWGRK LEW+PRAGRRSVGRP TRW+DDLVKV
Sbjct:  401 KIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKV 448          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 88.9669 bits (219), Expect = 7.046e-19
Identity = 39/48 (81.25%), Postives = 45/48 (93.75%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKV 48
            K+KWQWAGHIARR+DGRWGRK LEW+PR G+RSVGRP TRW+DDLVK+
Sbjct:  916 KLKWQWAGHIARRSDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKI 963          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|827536156|ref|XP_012544942.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101741607, partial [Bombyx mori])

HSP 1 Score: 83.9593 bits (206), Expect = 8.061e-18
Identity = 38/47 (80.85%), Postives = 43/47 (91.49%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVK 47
            ++KWQWAGHIARR DGRWGRK LEW+PR G+RSVGRP TRW+DDLVK
Sbjct:  193 ELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVK 239          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 82.4185 bits (202), Expect = 8.381e-18
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    2 IKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKVP 49
            +KWQWAGHIARR DGRWGRK LEW+PR G+RSVGRP TRW+DDLVK  
Sbjct:  117 LKWQWAGHIARRTDGRWGRKVLEWRPRIGKRSVGRPPTRWTDDLVKAA 164          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 85.5001 bits (210), Expect = 1.208e-17
Identity = 38/47 (80.85%), Postives = 43/47 (91.49%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVK 47
            ++KWQWAGHIARR DGRWGRK LEW+PR G+RSVGRP TRW+DDLVK
Sbjct:  916 ELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVK 962          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|827560966|ref|XP_012551328.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101744003 [Bombyx mori])

HSP 1 Score: 84.7297 bits (208), Expect = 2.468e-17
Identity = 38/47 (80.85%), Postives = 43/47 (91.49%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVK 47
            ++KWQWAGHIARR DGRWGRK LEW+PR G+RSVGRP TRW+DDLVK
Sbjct:  429 ELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVK 475          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 78.1814 bits (191), Expect = 1.711e-16
Identity = 35/47 (74.47%), Postives = 41/47 (87.23%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVK 47
            K+KWQWAGHIARR DGRW R+ LEW+PR G+RSVGRP  RW+DD+VK
Sbjct:   83 KLKWQWAGHIARRTDGRWSRRVLEWRPRTGKRSVGRPPARWTDDIVK 129          
BLAST of OSCA025853-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 82.4185 bits (202), Expect = 1.809e-16
Identity = 37/48 (77.08%), Postives = 42/48 (87.50%), Query Frame = 0
Query:    1 KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKV 48
             +KW+WAGHIARR DGRWGR+ LEW+PR GRRSVGRP  RW+DDLVKV
Sbjct:  693 NLKWRWAGHIARRTDGRWGRRVLEWRPRIGRRSVGRPPARWTDDLVKV 740          
The following BLAST results are available for this feature:
BLAST of OSCA025853-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|1.089e-2091.67reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|1.483e-2091.67reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|1.641e-2091.67reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|298204327|gb|ADI61812.1|7.046e-1981.25endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827536156|ref|XP_012544942.1|8.061e-1880.85PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|357603461|gb|EHJ63790.1|8.381e-1879.17endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204325|gb|ADI61811.1|1.208e-1780.85endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827560966|ref|XP_012551328.1|2.468e-1780.85PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|825740785|ref|WP_047149388.1|1.711e-1674.47hypothetical protein, partial [Escherichia coli][more]
gi|909577882|ref|XP_013144778.1|1.809e-1677.08PREDICTED: uncharacterized protein LOC106108224 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_36049contignewscf_36049:1042..1299 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025853-RAOSCA025853-RAOstrinia scapulalismRNAnewscf_36049 1042..1299 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025853-PA ID=OSCA025853-PA|Name=OSCA025853-RA|organism=Ostrinia scapulalis|type=polypeptide|length=85bp
KIKWQWAGHIARRADGRWGRKDLEWQPRAGRRSVGRPLTRWSDDLVKVPE
EVPGCERRRTGLSGYPWGRPLSSSGRTFFMRFCAK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity