OSCA025854-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025854-RA
Unique NameOSCA025854-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length76
Homology
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|827538598|ref|XP_012551571.1| (PREDICTED: uncharacterized protein LOC101737617 isoform X4 [Bombyx mori])

HSP 1 Score: 94.3597 bits (233), Expect = 6.095e-21
Identity = 52/75 (69.33%), Postives = 62/75 (82.67%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRMSPTH 75
            M+DDKSYT  KV  T+S  MERTYDMHNTTV+NSATM+KK+SAKRDILA KTSP+KK    +PQ+SPP + SPT+
Sbjct:  694 MLDDKSYT--KVPVTDSP-MERTYDMHNTTVVNSATMIKKTSAKRDILAGKTSPDKKG-NASPQKSPPRKFSPTN 764          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|827538594|ref|XP_012551561.1| (PREDICTED: uncharacterized protein LOC101737617 isoform X2 [Bombyx mori])

HSP 1 Score: 94.3597 bits (233), Expect = 6.404e-21
Identity = 52/75 (69.33%), Postives = 62/75 (82.67%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRMSPTH 75
            M+DDKSYT  KV  T+S  MERTYDMHNTTV+NSATM+KK+SAKRDILA KTSP+KK    +PQ+SPP + SPT+
Sbjct:  692 MLDDKSYT--KVPVTDSP-MERTYDMHNTTVVNSATMIKKTSAKRDILAGKTSPDKKG-NASPQKSPPRKFSPTN 762          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|827538592|ref|XP_012551555.1| (PREDICTED: uncharacterized protein LOC101737617 isoform X1 [Bombyx mori])

HSP 1 Score: 94.3597 bits (233), Expect = 6.467e-21
Identity = 52/75 (69.33%), Postives = 62/75 (82.67%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRMSPTH 75
            M+DDKSYT  KV  T+S  MERTYDMHNTTV+NSATM+KK+SAKRDILA KTSP+KK    +PQ+SPP + SPT+
Sbjct:  694 MLDDKSYT--KVPVTDSP-MERTYDMHNTTVVNSATMIKKTSAKRDILAGKTSPDKKG-NASPQKSPPRKFSPTN 764          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|827538596|ref|XP_012551567.1| (PREDICTED: uncharacterized protein LOC101737617 isoform X3 [Bombyx mori])

HSP 1 Score: 94.3597 bits (233), Expect = 7.480e-21
Identity = 52/75 (69.33%), Postives = 62/75 (82.67%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRMSPTH 75
            M+DDKSYT  KV  T+S  MERTYDMHNTTV+NSATM+KK+SAKRDILA KTSP+KK    +PQ+SPP + SPT+
Sbjct:  694 MLDDKSYT--KVPVTDSP-MERTYDMHNTTVVNSATMIKKTSAKRDILAGKTSPDKKG-NASPQKSPPRKFSPTN 764          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|913327985|ref|XP_013195476.1| (PREDICTED: uncharacterized protein LOC106138753 isoform X2 [Amyelois transitella])

HSP 1 Score: 90.8929 bits (224), Expect = 1.152e-19
Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRMSPT 74
            M+ DKSYT+TKV S     +ERTYDMHN TV+NSATMVK+ SAKRDIL+ K SPEKK + P P +SPPSR+SPT
Sbjct:  684 MVSDKSYTVTKVQSP----LERTYDMHNVTVLNSATMVKR-SAKRDILSVKGSPEKKFVSP-PLKSPPSRVSPT 751          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|913327983|ref|XP_013195475.1| (PREDICTED: uncharacterized protein LOC106138753 isoform X1 [Amyelois transitella])

HSP 1 Score: 90.8929 bits (224), Expect = 1.210e-19
Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRMSPT 74
            M+ DKSYT+TKV S     +ERTYDMHN TV+NSATMVK+ SAKRDIL+ K SPEKK + P P +SPPSR+SPT
Sbjct:  684 MVSDKSYTVTKVQSP----LERTYDMHNVTVLNSATMVKR-SAKRDILSVKGSPEKKFVSP-PLKSPPSRVSPT 751          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|509166045|gb|JAA81143.1| (Hypothetical protein, partial [Pararge aegeria])

HSP 1 Score: 77.0258 bits (188), Expect = 4.244e-17
Identity = 43/73 (58.90%), Postives = 58/73 (79.45%), Query Frame = 0
Query:    2 IDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTP-QRSPPSRMSP 73
            +DDKSYT+T+V S+ +  M +TYD+ NTTVINSAT+VKK++AKRDILA+K  PE+K+  PT  QR   +R+SP
Sbjct:    1 VDDKSYTVTRVQSS-ADNMVKTYDL-NTTVINSATLVKKTAAKRDILATKNYPERKLSTPTQMQRPSVNRVSP 71          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|914565899|gb|KOB70744.1| (Serine/threonine-protein kinase pakE [Operophtera brumata])

HSP 1 Score: 79.337 bits (194), Expect = 1.395e-15
Identity = 45/76 (59.21%), Postives = 55/76 (72.37%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPS-RMSPTH 75
            +IDDKSYT+   A    S +E TYDMHNTTVINSAT  KKS+AKRDILA+K SPE++I   +  R P S R+ PT+
Sbjct:  517 LIDDKSYTVA-AAGGGRSPLEATYDMHNTTVINSATAAKKSNAKRDILAAKGSPERRIPPSSQMRCPSSTRIPPTN 591          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|1073533559|gb|JAT83891.1| (hypothetical protein g.4114, partial [Pectinophora gossypiella])

HSP 1 Score: 76.6406 bits (187), Expect = 1.036e-14
Identity = 46/71 (64.79%), Postives = 54/71 (76.06%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRM 71
            M+DDKSYT+TK    NSSG     D++NTTVINSATMVKK SAKRDI+  KTSPEKKI  P   RSPP+++
Sbjct:  691 MVDDKSYTVTKAPIANSSG---GIDINNTTVINSATMVKK-SAKRDIM--KTSPEKKIAPPAQVRSPPAKV 755          
BLAST of OSCA025854-RA vs. genbank:protein
Match: gi|1073528955|gb|JAT81589.1| (hypothetical protein g.4111, partial [Pectinophora gossypiella])

HSP 1 Score: 75.0998 bits (183), Expect = 3.802e-14
Identity = 45/71 (63.38%), Postives = 54/71 (76.06%), Query Frame = 0
Query:    1 MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILASKTSPEKKILGPTPQRSPPSRM 71
            M+DDKSYT+TK    NSSG     D++NTTVINSATMVKK SAKRDI+  KTSPEKKI  P   +SPP+++
Sbjct:  691 MVDDKSYTVTKAPIANSSG---GIDINNTTVINSATMVKK-SAKRDIM--KTSPEKKIAPPAQVKSPPAKV 755          
The following BLAST results are available for this feature:
BLAST of OSCA025854-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 10
Match NameE-valueIdentityDescription
gi|827538598|ref|XP_012551571.1|6.095e-2169.33PREDICTED: uncharacterized protein LOC101737617 is... [more]
gi|827538594|ref|XP_012551561.1|6.404e-2169.33PREDICTED: uncharacterized protein LOC101737617 is... [more]
gi|827538592|ref|XP_012551555.1|6.467e-2169.33PREDICTED: uncharacterized protein LOC101737617 is... [more]
gi|827538596|ref|XP_012551567.1|7.480e-2169.33PREDICTED: uncharacterized protein LOC101737617 is... [more]
gi|913327985|ref|XP_013195476.1|1.152e-1967.57PREDICTED: uncharacterized protein LOC106138753 is... [more]
gi|913327983|ref|XP_013195475.1|1.210e-1967.57PREDICTED: uncharacterized protein LOC106138753 is... [more]
gi|509166045|gb|JAA81143.1|4.244e-1758.90Hypothetical protein, partial [Pararge aegeria][more]
gi|914565899|gb|KOB70744.1|1.395e-1559.21Serine/threonine-protein kinase pakE [Operophtera ... [more]
gi|1073533559|gb|JAT83891.1|1.036e-1464.79hypothetical protein g.4114, partial [Pectinophora... [more]
gi|1073528955|gb|JAT81589.1|3.802e-1463.38hypothetical protein g.4111, partial [Pectinophora... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_40501contignewscf_40501:43..270 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025854-RAOSCA025854-RAOstrinia scapulalismRNAnewscf_40501 43..270 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025854-PA ID=OSCA025854-PA|Name=OSCA025854-RA|organism=Ostrinia scapulalis|type=polypeptide|length=76bp
MIDDKSYTLTKVASTNSSGMERTYDMHNTTVINSATMVKKSSAKRDILAS
KTSPEKKILGPTPQRSPPSRMSPTHA
back to top