OSCA025855-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025855-RA
Unique NameOSCA025855-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length94
Homology
BLAST of OSCA025855-RA vs. genbank:protein
Match: gi|512935605|ref|XP_004933314.1| (PREDICTED: uncharacterized protein LOC101739238 [Bombyx mori])

HSP 1 Score: 65.855 bits (159), Expect = 4.361e-12
Identity = 34/58 (58.62%), Postives = 38/58 (65.52%), Query Frame = 0
Query:    4 DFHNDRCCAARLQESTATFTRSSVYLVGGLPTLHLLVRGGQLKTFLPHRPLALRAMCP 61
            DF  DR  A  +Q   A F RSSV+LVGG PTL L VRG   + FLPHRP +LRAM P
Sbjct:   48 DFQCDRSIATCIQRDPALFIRSSVHLVGGRPTLRLPVRGRHSRIFLPHRPSSLRAMWP 105          
BLAST of OSCA025855-RA vs. genbank:protein
Match: gi|930665739|gb|KPJ06866.1| (hypothetical protein RR48_11365 [Papilio machaon])

HSP 1 Score: 65.4698 bits (158), Expect = 1.522e-10
Identity = 33/57 (57.89%), Postives = 38/57 (66.67%), Query Frame = 0
Query:    1 SPKDFHNDRCCAARLQESTATFTRSSVYLVGGLPTLHLLVRGGQLKTFLPHRPLALR 57
            SPKD H+D  CA R+Q++ AT TRSSV+L GGL TL   VRG    T  PHRP  LR
Sbjct:  191 SPKDRHDDGSCATRIQDTPATLTRSSVHLAGGLRTLRQPVRGRHSSTLRPHRPSILR 247          
The following BLAST results are available for this feature:
BLAST of OSCA025855-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|512935605|ref|XP_004933314.1|4.361e-1258.62PREDICTED: uncharacterized protein LOC101739238 [B... [more]
gi|930665739|gb|KPJ06866.1|1.522e-1057.89hypothetical protein RR48_11365 [Papilio machaon][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_30266contignewscf_30266:646..930 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025855-RAOSCA025855-RAOstrinia scapulalismRNAnewscf_30266 646..930 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025855-PA ID=OSCA025855-PA|Name=OSCA025855-RA|organism=Ostrinia scapulalis|type=polypeptide|length=94bp
SPKDFHNDRCCAARLQESTATFTRSSVYLVGGLPTLHLLVRGGQLKTFLP
HRPLALRAMCPSNCVILAIGSAGYLGHLGSPVDLLISDLITQGN
back to top