OSCA025856-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025856-RA
Unique NameOSCA025856-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length65
Homology
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|913331943|ref|XP_013197573.1| (PREDICTED: thioredoxin reductase 1, mitochondrial-like [Amyelois transitella])

HSP 1 Score: 125.176 bits (313), Expect = 2.687e-33
Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    5 LLDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            LLDG+FDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP
Sbjct:   11 LLDGSFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 71          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|389615000|dbj|BAM20500.1| (thioredoxin reductase 1, partial [Papilio polytes])

HSP 1 Score: 114.005 bits (284), Expect = 7.927e-31
Identity = 55/59 (93.22%), Postives = 55/59 (93.22%), Query Frame = 0
Query:    7 DGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
             G FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:   39 HGTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 97          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|509181805|gb|JAA89023.1| (thioredoxin reductase [Pararge aegeria])

HSP 1 Score: 120.553 bits (301), Expect = 1.271e-30
Identity = 56/60 (93.33%), Postives = 59/60 (98.33%), Query Frame = 0
Query:    6 LDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            +DG +DYDLAVIGGGSGGLACAKEAVNQGA+VAVLDYVTPSPQGTKWGLGGTCVNVGCIP
Sbjct:    4 IDGTYDYDLAVIGGGSGGLACAKEAVNQGARVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 63          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|909551447|ref|XP_013140289.1| (PREDICTED: thioredoxin reductase 1, mitochondrial isoform X3 [Papilio polytes])

HSP 1 Score: 120.553 bits (301), Expect = 1.687e-30
Identity = 55/58 (94.83%), Postives = 55/58 (94.83%), Query Frame = 0
Query:    8 GNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            G FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:   40 GTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 97          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|943973525|ref|XP_014368138.1| (PREDICTED: thioredoxin reductase 1, mitochondrial isoform X1 [Papilio machaon])

HSP 1 Score: 119.783 bits (299), Expect = 2.468e-30
Identity = 55/58 (94.83%), Postives = 55/58 (94.83%), Query Frame = 0
Query:    8 GNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            G FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:   35 GTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 92          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|734670932|gb|AJA32127.1| (thioredoxin reductase [Helicoverpa armigera])

HSP 1 Score: 118.627 bits (296), Expect = 6.141e-30
Identity = 57/59 (96.61%), Postives = 57/59 (96.61%), Query Frame = 0
Query:    7 DGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
             GNFDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP
Sbjct:   34 HGNFDYDLAVIGGGSGGLACAKEAVNLGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 92          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|909551453|ref|XP_013140311.1| (PREDICTED: thioredoxin reductase 1, mitochondrial isoform X6 [Papilio polytes])

HSP 1 Score: 117.472 bits (293), Expect = 1.327e-29
Identity = 56/60 (93.33%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    6 LDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            +DG FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:    4 IDGTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 63          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|909551451|ref|XP_013140305.1| (PREDICTED: thioredoxin reductase 1, mitochondrial isoform X5 [Papilio polytes])

HSP 1 Score: 117.472 bits (293), Expect = 1.367e-29
Identity = 57/61 (93.44%), Postives = 57/61 (93.44%), Query Frame = 0
Query:    5 LLDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            L DG FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:    8 LKDGTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 68          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|943973528|ref|XP_014368139.1| (PREDICTED: thioredoxin reductase 1, mitochondrial isoform X2 [Papilio machaon])

HSP 1 Score: 117.472 bits (293), Expect = 1.644e-29
Identity = 56/60 (93.33%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    6 LDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            +DG FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:    4 IDGTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 63          
BLAST of OSCA025856-RA vs. genbank:protein
Match: gi|910315771|ref|XP_013182165.1| (PREDICTED: thioredoxin reductase 1, mitochondrial isoform X4 [Papilio xuthus])

HSP 1 Score: 117.087 bits (292), Expect = 2.099e-29
Identity = 56/60 (93.33%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    6 LDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGTKWGLGGTCVNVGCIP 65
            +DG FDYDLAVIGGGSGGLACAKEAVN GAKVAVLDYVTPSP GTKWGLGGTCVNVGCIP
Sbjct:    4 IDGTFDYDLAVIGGGSGGLACAKEAVNHGAKVAVLDYVTPSPLGTKWGLGGTCVNVGCIP 63          
The following BLAST results are available for this feature:
BLAST of OSCA025856-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913331943|ref|XP_013197573.1|2.687e-3398.36PREDICTED: thioredoxin reductase 1, mitochondrial-... [more]
gi|389615000|dbj|BAM20500.1|7.927e-3193.22thioredoxin reductase 1, partial [Papilio polytes][more]
gi|509181805|gb|JAA89023.1|1.271e-3093.33thioredoxin reductase [Pararge aegeria][more]
gi|909551447|ref|XP_013140289.1|1.687e-3094.83PREDICTED: thioredoxin reductase 1, mitochondrial ... [more]
gi|943973525|ref|XP_014368138.1|2.468e-3094.83PREDICTED: thioredoxin reductase 1, mitochondrial ... [more]
gi|734670932|gb|AJA32127.1|6.141e-3096.61thioredoxin reductase [Helicoverpa armigera][more]
gi|909551453|ref|XP_013140311.1|1.327e-2993.33PREDICTED: thioredoxin reductase 1, mitochondrial ... [more]
gi|909551451|ref|XP_013140305.1|1.367e-2993.44PREDICTED: thioredoxin reductase 1, mitochondrial ... [more]
gi|943973528|ref|XP_014368139.1|1.644e-2993.33PREDICTED: thioredoxin reductase 1, mitochondrial ... [more]
gi|910315771|ref|XP_013182165.1|2.099e-2993.33PREDICTED: thioredoxin reductase 1, mitochondrial ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0098869 cellular oxidant detoxification
biological_process GO:0055114 oxidation-reduction process
cellular_component GO:0005623 cell
molecular_function GO:0050660 flavin adenine dinucleotide binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0016668 oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
molecular_function GO:0004791 thioredoxin-disulfide reductase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00411PNDRDTASEIcoord: 13..35
score: 47.1
coord: 54..65
score: 61.09
NoneNo IPR availableGENE3D3.50.50.60coord: 9..65
e-value: 7.2E-19
score: 67.6
NoneNo IPR availablePANTHERPTHR22912DISULFIDE OXIDOREDUCTASEcoord: 9..65
NoneNo IPR availableSUPERFAMILY51905FAD/NAD(P)-binding domaincoord: 11..65
IPR023753Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domainPFAMPF07992Pyr_redox_2coord: 13..65
e-value: 3.6E-10
score: 39.9
IPR006338Thioredoxin/glutathione reductase selenoproteinPANTHERPTHR22912:SF23THIOREDOXIN REDUCTASE 1coord: 9..65
IPR012999Pyridine nucleotide-disulphide oxidoreductase, class I, active sitePROSITEPS00076PYRIDINE_REDOX_1coord: 55..65

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19529contignewscf_19529:3..197 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025856-RAOSCA025856-RAOstrinia scapulalismRNAnewscf_19529 3..197 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025856-PA ID=OSCA025856-PA|Name=OSCA025856-RA|organism=Ostrinia scapulalis|type=polypeptide|length=65bp
MVWCLLDGNFDYDLAVIGGGSGGLACAKEAVNQGAKVAVLDYVTPSPQGT
KWGLGGTCVNVGCIP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005623cell
Vocabulary: Biological Process
TermDefinition
GO:0045454cell redox homeostasis
GO:0098869cellular oxidant detoxification
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0050660flavin adenine dinucleotide binding
GO:0016668oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0004791thioredoxin-disulfide reductase activity
GO:0016491oxidoreductase activity
Vocabulary: INTERPRO
TermDefinition
IPR012999Pyr_OxRdtase_I_AS
IPR006338Thioredoxin/glutathione_Rdtase
IPR023753Pyr_nucl-diS_OxRdtase_FAD/NAD