OSCA025857-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025857-RA
Unique NameOSCA025857-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length350
Homology
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|914564387|gb|KOB69846.1| (Zinc finger DNA binding protein, partial [Operophtera brumata])

HSP 1 Score: 282.337 bits (721), Expect = 3.074e-89
Identity = 147/354 (41.53%), Postives = 225/354 (63.56%), Query Frame = 0
Query:    8 WGCCAQDINAEKDKCLRCDVCNKSFHLECLAI-ELSSKLSS-------WTCPSCAAKAPKAKTNDNTPVRFNPNITVRTHKRPALQSPPGPSDNPITGESVRAIVQEVIQKQFESFSTTLRSIFNA----ELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            WGCC  D+  E    + C +C+K +HL+C+A  E+   ++S       W CPSC+AK+   K+ ++TP+R       R  KR AL SPP  +D+ +T + VR +VQE+  ++ E+    L    +A    EL  I++EM + + S+ +++ QFE V        E++KE+  +N + + S    A          R  NIE+QCVP++ NEN++ +V  I  +I C++K++NILSCSR+ K+N    RP+SIVVQFNSPR RDTFLA+SI FN++   +++LN+SH+G +  K+PIF+ EHLS +NKALH+A R  A+EKGYK VWVR GRI+ RK++ S+Y  I+++++LN +
Sbjct:   10 WGCCDADV--EDCDFILCSLCHKGYHLDCIATTEVGKNIASGQDVSPNWACPSCSAKS---KSRNSTPLRSQN----RPPKRAALNSPPK-TDSSLTRDDVRDVVQELFYREMENLFIRLSQQISASMVSELAPIKKEMSELRASITFINEQFEGVLMKQTSVTEEMKEIHAENAENAFSEHGYA----------RGNNIEVQCVPERNNENVINIVQNISDIIGCDIKDENILSCSRIAKLNPKGARPRSIVVQFNSPRVRDTFLASSIKFNKS-NTSNRLNSSHIGLNGEKTPIFVVEHLSASNKALHSAARLAAREKGYKFVWVRNGRIFMRKTETSDYKIIKNLEALNNL 342          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|768436806|ref|XP_011559912.1| (PREDICTED: uncharacterized protein LOC105390325 [Plutella xylostella])

HSP 1 Score: 263.462 bits (672), Expect = 6.919e-83
Identity = 131/296 (44.26%), Postives = 194/296 (65.54%), Query Frame = 0
Query:   64 DNTPVRFNPNITVRTHKRPALQSPPGPSDN-----PITGESVRAIVQEVIQKQFESFSTTLR----SIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKIV 350
            +++P+  + +I  R  KR A  S P    N     P+T   VR IV ++++ Q   F + L     S  N EL  ++ E++   +S+ +++ Q+E++ +  K   + + +L+++N +L ++V  +  ++N LEQ +RS NIEIQCVP+  NEN+ ++VT +G  I C V EDNIL C+RV K ++ + RP+SIV Q +SP+ RDTFLAA+I +NR     +KLNTS +G+   K  IF+TEHLSP NKALHAA R KAKE  YKHVWVR GRI+ RKSDDS Y+F++DMD +NK++
Sbjct:   25 NDSPITTDTHIINRPQKRLAPSSSPEMDQNQEVSSPVTRNDVRDIVTDIVKSQMTIFMSQLNESIASTINKELAVMKTELEGVTESMGFINKQYEEMMQAFKVVSKDVSQLKEENTQLKNTVTTLNHKLNFLEQNARSNNIEIQCVPENRNENIFSIVTNLGATIGCAVTEDNILQCTRVPKADRTSARPRSIVAQLSSPKLRDTFLAATIKYNRANP-GNKLNTSSIGYAGEKKAIFVTEHLSPVNKALHAAARLKAKELKYKHVWVRNGRIFMRKSDDSAYLFVKDMDFINKLI 319          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|768410864|ref|XP_011560619.1| (PREDICTED: uncharacterized protein LOC105390936 [Plutella xylostella])

HSP 1 Score: 257.299 bits (656), Expect = 5.118e-80
Identity = 130/348 (37.36%), Postives = 211/348 (60.63%), Query Frame = 0
Query:   11 CAQDINAEKDKCLRCDVCNKSFHLECLAIELS----SKLSSWTCPSCAAKAPKAKTNDNTPVRFNPNITVRTHKRPALQSPPGPSDN----PITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFD-DGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            C  DIN  K+  + C  C  S+H +C+ + ++    +   +W CPSC  K P+   N NTPV+ N  +T+R+  R A  S P P+          E +  I  E+ +   +  +  + +   ++LK +R+E++D K S+ + ++ FE+   +    K  I+++Q +ND L +S   +  R+N LEQ +R  N+E+QCVP+   EN LT VTQ+G +INC+V+E +I  CSR  K N  + RP+SI+V+F+S R RD++L A+  +N+     DKLNT+ LG   + +SP+++ EHL+P  K+LH+A R KAKE G+K  WV+ GR+  RKS++S+YV +RD+ ++N +
Sbjct:    8 CNVDINIIKENHIDCSKCKNSYHNQCVGVPVAKTQKAAQPTWICPSCNIKQPRGD-NSNTPVQQNEKVTLRSKLREARASAPAPTSPCRQCGTQEELINTIRNEIREAMRDDLTGIINTCLKSQLKQLRDEINDVKDSISFTNAMFEEFKAEVVSAKNSIQQVQKENDNLRASTCTLLQRVNQLEQLNRMSNLELQCVPEVKGENALTYVTQLGHIINCKVQESDISYCSRTAKANPQSSRPRSILVKFHSSRTRDSYLNAASKYNKDNP-NDKLNTALLGMALEKRSPVYVVEHLTPDTKSLHSAARLKAKELGWKFTWVKNGRVLMRKSENSDYVLVRDITTVNNL 353          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|914563653|gb|KOB69383.1| (Zinc finger DNA binding protein [Operophtera brumata])

HSP 1 Score: 255.758 bits (652), Expect = 3.591e-79
Identity = 141/370 (38.11%), Postives = 222/370 (60.00%), Query Frame = 0
Query:   11 CAQDINAEKDKCLRCDVCNKSFHLEC--LAIE----LSSKLSSWTCPSCAAKAPKAKTNDNTPVR-------------------FNPNITVRTHKRP---ALQSPPGPS---DNPITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            C + IN    +C+ C VC + + L+C  LA++    L+   +SW C  C  K PK   N  TP+R                      NIT R  +RP   A Q P       D P+TG+++RAI+ + I       S+ L +I   E K++RE +D +++++ ++S +++++    +E  EKI  L+ +N+ L  SV+ +  R+N+ EQ +R+ NIE+QCVP+  +EN++  V  IGKVI   +K+ +I  C+R+ K + D+ RP+SI+V+FN+PR RD FLA++I FNR+ Q  ++LNTSHLG  D   PI++ EHLS  NK+LHAA R +AKE G++ VWVR G I+ RKS+DS+ +F+ + + L ++
Sbjct:    9 CLKTINT--SECMNCFVCRQWYDLDCANLAVKQFRLLTDGRNSWKCAGCRNKEPKG-NNTETPIRPEQPTTRAKAKISQISPAAVGSNITTRNKRRPQSPARQLPEHTEEDDDFPLTGKALRAIINQEI-------SSKLSTIL-LEQKNLREVVDGFQQNISFLSEKYDELKSALEEKSEKIASLEKKNNVLQESVQNLTKRLNNTEQHARANNIEVQCVPENKSENIINTVLNIGKVIKSNIKDADIAHCTRIAKKDSDSNRPRSILVKFNTPRLRDAFLASAIKFNRS-QPENRLNTSHLGATDKPLPIYVVEHLSADNKSLHAAARARAKELGFRFVWVRNGHIFMRKSEDSDRIFVDNAEKLKEL 366          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|768420470|ref|XP_011551003.1| (PREDICTED: ubiquitin-like modifier-activating enzyme ATG7 [Plutella xylostella])

HSP 1 Score: 263.848 bits (673), Expect = 4.384e-79
Identity = 122/255 (47.84%), Postives = 186/255 (72.94%), Query Frame = 0
Query:   95 ITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            +T + VR I+Q  ++      + ++ ++FN+ELKSI++E+ D K+S+ +MS+Q+ED     K T E I  L+ QND+L++ V ++  ++N++EQ +R+ NIEIQC+P+  +EN++ LV +IG+V+NC++ +  IL C+RV K+N+++ RP+SIV Q +SP+ RD  LAA INFN++    DKLNTSH+G    K P+F+ EHLS ANKA+H+A R KAKE GYK VWVR GR+Y RK D SEY FI+D+++L+K+
Sbjct:  412 MTQDDVRNIIQAEMKSLLSELNKSMATMFNSELKSIKDEIKDVKESMTFMSNQYEDFISIQKNTTEDITMLKRQNDELNTKVNDLTYKMNAMEQNARANNIEIQCLPEINSENVVNLVEKIGEVVNCKISDREILHCTRVAKMNRNSARPRSIVTQLSSPKLRDELLAAVINFNKSNP-HDKLNTSHIGIKGDKKPVFVVEHLSSANKAIHSAARLKAKELGYKFVWVRKGRVYMRKDDTSEYRFIKDIETLDKL 665          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|914570797|gb|KOB74078.1| (Zinc finger DNA binding protein [Operophtera brumata])

HSP 1 Score: 254.988 bits (650), Expect = 5.968e-79
Identity = 141/370 (38.11%), Postives = 221/370 (59.73%), Query Frame = 0
Query:   11 CAQDINAEKDKCLRCDVCNKSFHLEC--LAIE----LSSKLSSWTCPSCAAKAPKAKTNDNTPVR-------------------FNPNITVRTHKRP---ALQSPPGPS---DNPITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            C   IN    +C+ C VC + + L+C  LA++    L+   +SW C  C  K PK   N  TP+R                      NIT R  +RP   A Q P       D P+TG+++RAI+ + I       S+ L +I   E K++RE +D +++++ ++S +++++    +E  EKI  L+ +N+ L  SV+ +  R+N+ EQ +R+ NIE+QCVP+  +EN++  V  IGKVI   +K+ +I  C+R+ K + D+ RP+SI+V+FN+PR RD FLA++I FNR+ Q  ++LNTSHLG  D   PI++ EHLS  NK+LHAA R +AKE G++ VWVR G I+ RKS+DS+ +F+ + + L ++
Sbjct:    9 CLNTINT--SECMNCFVCRQWYDLDCANLAVKQFRLLTDGRNSWKCAGCRNKEPKG-NNTETPIRPEQPTTRAKSKISQISPAAVGSNITTRNKRRPQSPARQLPEHTEEDDDFPLTGKALRAIINQEI-------SSKLSTIL-LEQKNLREVVDGFQQNISFLSEKYDELKSALEEKSEKIASLEKKNNVLQESVQNLTKRLNNTEQHARANNIEVQCVPENKSENIINTVLNIGKVIKSNIKDADIAHCTRIAKKDSDSNRPRSILVKFNTPRLRDAFLASAIKFNRS-QPENRLNTSHLGATDKPLPIYVVEHLSADNKSLHAAARARAKELGFRFVWVRNGHIFMRKSEDSDRIFVDNAEKLKEL 366          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|768423236|ref|XP_011552515.1| (PREDICTED: uncharacterized protein LOC105384052 [Plutella xylostella])

HSP 1 Score: 256.529 bits (654), Expect = 3.377e-78
Identity = 138/334 (41.32%), Postives = 209/334 (62.57%), Query Frame = 0
Query:   25 CDVCNKSFHLECLAIELS-SKLSSWTCPSCAAKAPKAKTNDNTPVR-FNP-----NITVRTHKR--PALQSPPGPSDNPITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            CD C          IE S  K   W C  C +  PK    D+TPV    P      +T R+ KR  P+         +P++ E VR I++  I       + +L  IFN+EL+SI+E++  +K+S++++++Q+ED  KD K     I++L+ QN +L+S+V++++ R+N LEQ++R KN+EIQCVP+  +ENL+  + +I +V+ C + E+ I  C+R++K+++ + RP+SIV +F S + RD FLAA I FNR+     KLNTSH+     K PI++ EHLSPANK LHAA R KAKE  YK+VWV+ GRI+ RK+D SEY +I++  SL K+
Sbjct:  150 CDAC---------LIETSIDKYDVWICSLCTSLKPKGGKRDDTPVHPATPSEQEKGVTKRSKKRFAPSSSPESASQQSPLSHEDVREIIKSEIHSLVPELTKSLSGIFNSELRSIKEDIQCFKESMNFLNNQYEDFLKDQKLNTVHIEQLKSQNQELTSTVQDLSYRLNDLEQRARDKNVEIQCVPESRSENLINTLCKICEVVECPITEEQITRCTRIVKLDRSSARPRSIVAEFASNKHRDRFLAAVIKFNRS-HPDGKLNTSHIDVKGPKKPIYVVEHLSPANKHLHAAARAKAKELNYKYVWVKNGRIFMRKTDHSEYKYIQNDLSLGKL 473          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|914570604|gb|KOB73935.1| (Zinc finger DNA binding protein, partial [Operophtera brumata])

HSP 1 Score: 253.832 bits (647), Expect = 9.825e-78
Identity = 141/370 (38.11%), Postives = 220/370 (59.46%), Query Frame = 0
Query:   11 CAQDINAEKDKCLRCDVCNKSFHLEC--LAIE----LSSKLSSWTCPSCAAKAPKAKTNDNTPVR-------------------FNPNITVRTHKRP---ALQSPPGPS---DNPITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKI 349
            C   IN    +C+ C VC + + L+C  LA++    L+   +SW C  C  K PK   N  TP+R                      NIT R  +RP   A Q P       D P+TG+++RAI+ + I       S+ L +I   E K++RE +D +++++ ++S +++++    +E  EKI  L+ +N+ L  SV+ +  R+N+ EQ +R+ NIE+QCVP+  +EN++  V  IGKVI   +K+ +I  C+R+ K + D+ RP+SI+V+FN+PR RD FLA++I FNR+ Q  ++LNTSHLG  D   PI++ EHLS  NK+LHAA R +AKE G++ VWVR G I+ RKS+DS+ +F+ + + + K 
Sbjct:    9 CLNTINT--SECMNCFVCRQWYDLDCANLAVKQFRLLTDGRNSWKCAGCRNKEPKG-NNTETPIRPEQPTTRAKAKISQISPAAVGSNITTRNKRRPQSPARQLPEHTEEDDDFPLTGKALRAIINQEI-------SSKLSTIL-LEQKNLREVVDGFQQNISFLSEKYDELKSALEEKSEKIASLEKKNNVLQESVQNLTKRLNNTEQHARANNIEVQCVPENKSENIINTVLNIGKVIKSNIKDADIAHCTRIAKKDSDSNRPRSILVKFNTPRLRDAFLASAIKFNRS-QPENRLNTSHLGATDKPLPIYVVEHLSADNKSLHAAARARAKELGFRFVWVRNGHIFMRKSEDSDRIFVDNAEKMPKF 366          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|914555299|gb|KOB65231.1| (Zinc finger DNA binding protein [Operophtera brumata])

HSP 1 Score: 249.21 bits (635), Expect = 1.338e-76
Identity = 123/343 (35.86%), Postives = 209/343 (60.93%), Query Frame = 0
Query:   23 LRCDVCNKSFHLECLAIELSSKL--------SSWTCPSCAAKAPKAKTNDNTPVRFN----------PNITVRTHKRPALQSPPGPSDNPITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLN 347
            L+C +C   FH EC  I  S K         S+W CP+C +K P+   N NTP+R N           N+T+R     A+      +  P+T E+V+ ++Q+               I + + K I +E+++ K S+ Y+++Q+E + ++ +   +++K L+++N+ L ++VK++  R++ +EQ SR  NIEIQC+P+   ENL+ +V QI ++   +++E +I  C+R+ K+N +NKRP+S+V++F+SPR RD+F+A  I FN+ K   DKLNTSH+G    K P+++ +HL+P  K +HAA R  A++  YK VW++ GR++ RKS+ SE++ IRD+  L+
Sbjct:   31 LKCGICALRFHFEC-GISTSKKFEEISPAYRSTWVCPTCHSKQPRGD-NSNTPIRGNCTVASDGDSTANVTMRRKNNSAV------TQGPLTLENVKELMQKSSDDLLNRMERKFTKIMDVKTKEIFKEVNEIKDSISYLNAQYEGMKEELRLKCDQMKNLKEENEALKTTVKDINNRLSVMEQHSRISNIEIQCIPEHKTENLVNVVAQIARITGSKLEERDIHKCTRIAKINPENKRPRSVVIKFSSPRVRDSFMAGVIQFNK-KNRNDKLNTSHIGIVGEKKPVYVVDHLTPVMKKIHAAAREVARKLQYKFVWIKNGRVFMRKSETSEHIIIRDLCQLD 364          
BLAST of OSCA025857-RA vs. genbank:protein
Match: gi|914543934|gb|KOB57787.1| (Zinc finger DNA binding protein [Operophtera brumata])

HSP 1 Score: 248.054 bits (632), Expect = 2.912e-76
Identity = 123/343 (35.86%), Postives = 209/343 (60.93%), Query Frame = 0
Query:   23 LRCDVCNKSFHLECLAIELSSKL--------SSWTCPSCAAKAPKAKTNDNTPVRFN----------PNITVRTHKRPALQSPPGPSDNPITGESVRAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFEDVTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCVPQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQFNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPANKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLN 347
            L+C +C   FH EC  I  S K         S+W CP+C +K P+   N NTP+R N           N+T+R     A+      +  P+T E+V+ ++Q+               I + + K I +E+++ K S+ Y+++Q+E + ++ +   +++K L+++N+ L ++VK++  R++ +EQ SR  NIEIQC+P+   ENL+ +V QI ++   +++E +I  C+R+ K+N +NKRP+S+V++F+SPR RD+F+A  I FN+ K   DKLNTSH+G    K P+++ +HL+P  K +HAA R  A++  YK VW++ GR++ RKS+ SE++ IRD+  L+
Sbjct:   31 LKCGICALRFHFEC-GICTSKKFEEISPAYRSTWVCPTCHSKRPRGD-NSNTPIRGNCTVASDGDSTANVTMRRKNNSAV------TQGPLTLENVKELMQKSSDDLLNRMERKFTKIMDVKTKEIFKEVNEIKDSISYLNAQYEGMKEELRLKCDQMKNLKEENEALKTTVKDINNRLSVMEQHSRISNIEIQCIPEHKTENLVNVVAQIARITGSKLEERDIHKCTRIAKINPENKRPRSVVIKFSSPRVRDSFMAGVIQFNK-KNRNDKLNTSHIGIGGEKKPVYVVDHLTPVMKKIHAAAREVARKLQYKFVWIKNGRVFMRKSETSEHIIIRDLCQLD 364          
The following BLAST results are available for this feature:
BLAST of OSCA025857-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914564387|gb|KOB69846.1|3.074e-8941.53Zinc finger DNA binding protein, partial [Operopht... [more]
gi|768436806|ref|XP_011559912.1|6.919e-8344.26PREDICTED: uncharacterized protein LOC105390325 [P... [more]
gi|768410864|ref|XP_011560619.1|5.118e-8037.36PREDICTED: uncharacterized protein LOC105390936 [P... [more]
gi|914563653|gb|KOB69383.1|3.591e-7938.11Zinc finger DNA binding protein [Operophtera bruma... [more]
gi|768420470|ref|XP_011551003.1|4.384e-7947.84PREDICTED: ubiquitin-like modifier-activating enzy... [more]
gi|914570797|gb|KOB74078.1|5.968e-7938.11Zinc finger DNA binding protein [Operophtera bruma... [more]
gi|768423236|ref|XP_011552515.1|3.377e-7841.32PREDICTED: uncharacterized protein LOC105384052 [P... [more]
gi|914570604|gb|KOB73935.1|9.825e-7838.11Zinc finger DNA binding protein, partial [Operopht... [more]
gi|914555299|gb|KOB65231.1|1.338e-7635.86Zinc finger DNA binding protein [Operophtera bruma... [more]
gi|914543934|gb|KOB57787.1|2.912e-7635.86Zinc finger DNA binding protein [Operophtera bruma... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 120..141
NoneNo IPR availableCOILSCoilCoilcoord: 148..190
NoneNo IPR availableGENE3D1.10.287.950coord: 130..192
e-value: 4.2E-4
score: 19.4
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 10..55
e-value: 1.1E-6
score: 28.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 9..59
e-value: 8.2E-8
score: 31.4
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILY57903FYVE/PHD zinc fingercoord: 9..59

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_28305contignewscf_28305:538..1590 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025857-RAOSCA025857-RAOstrinia scapulalismRNAnewscf_28305 538..1590 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025857-PA ID=OSCA025857-PA|Name=OSCA025857-RA|organism=Ostrinia scapulalis|type=polypeptide|length=350bp
MSVLTSDWGCCAQDINAEKDKCLRCDVCNKSFHLECLAIELSSKLSSWTC
PSCAAKAPKAKTNDNTPVRFNPNITVRTHKRPALQSPPGPSDNPITGESV
RAIVQEVIQKQFESFSTTLRSIFNAELKSIREEMDDYKKSVDYMSSQFED
VTKDNKETKEKIKELQDQNDKLSSSVKEMAVRINSLEQQSRSKNIEIQCV
PQKTNENLLTLVTQIGKVINCEVKEDNILSCSRVMKVNKDNKRPKSIVVQ
FNSPRFRDTFLAASINFNRTKQMADKLNTSHLGFDDGKSPIFITEHLSPA
NKALHAATRTKAKEKGYKHVWVRGGRIYARKSDDSEYVFIRDMDSLNKIV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR011011Znf_FYVE_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger