OSCA025858-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025858-RA
Unique NameOSCA025858-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length91
Homology
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|827563895|ref|XP_012552454.1| (PREDICTED: craniofacial development protein 2-like, partial [Bombyx mori])

HSP 1 Score: 83.9593 bits (206), Expect = 8.077e-18
Identity = 39/66 (59.09%), Postives = 50/66 (75.76%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNAKLG+R D+ELKV  FG+G+RN   ++LA F+E E LF+MNSF +KP Q K TWL P+G  +
Sbjct:   99 GDFNAKLGRRGDDELKVGPFGFGQRNPRGQMLADFMEKEGLFMMNSFFKKPPQRKWTWLSPDGVTR 164          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 83.9593 bits (206), Expect = 5.340e-17
Identity = 39/66 (59.09%), Postives = 50/66 (75.76%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNAKLG+R D+ELKV  FG+G+RN   ++LA F+E E LF+MNSF +KP Q K TWL P+G  +
Sbjct:  189 GDFNAKLGRRGDDELKVGPFGFGQRNPRGQMLADFMEKEGLFMMNSFFKKPPQRKWTWLSPDGVTR 254          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|943952592|ref|XP_014359162.1| (PREDICTED: craniofacial development protein 2-like [Papilio machaon])

HSP 1 Score: 83.5741 bits (205), Expect = 5.501e-17
Identity = 40/66 (60.61%), Postives = 49/66 (74.24%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNAKLGKR   EL++  FGYG+RN    LLAGF+E E L++MNSF RK +Q K TW+ P+GA K
Sbjct:  186 GDFNAKLGKRDGEELRLGNFGYGQRNHRGHLLAGFMEKEGLYMMNSFFRKQEQRKWTWMSPDGATK 251          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|827556468|ref|XP_012549585.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101742651 [Bombyx mori])

HSP 1 Score: 83.5741 bits (205), Expect = 6.181e-17
Identity = 39/66 (59.09%), Postives = 50/66 (75.76%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNAKLG+R D+ELKV  FG+G+RN   ++LA F+E E LF+MNSF +KP Q K TWL P+G  +
Sbjct:    2 GDFNAKLGRRGDDELKVGPFGFGQRNPRGQMLADFMEKEGLFMMNSFFKKPPQRKWTWLSPDGVTR 67          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 83.1889 bits (204), Expect = 1.086e-16
Identity = 40/66 (60.61%), Postives = 49/66 (74.24%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNA+LGKR++ EL+V  FG+G RN    LLAGF+E E LF+MNSF +K    K TW+ PNGAIK
Sbjct:  187 GDFNARLGKRSEGELRVGPFGFGNRNHRGNLLAGFMEKEELFMMNSFFQKRNHRKWTWMSPNGAIK 252          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 79.7221 bits (195), Expect = 1.534e-15
Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNAKLG R+++ELKV  FGYG+RN+  + LA F+E E L++MNSF +KP   K TW+ P+G  K
Sbjct:  189 GDFNAKLGCRSNDELKVGQFGYGQRNSRGQRLADFLEKEGLYMMNSFFQKPPHRKWTWMSPDGVTK 254          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 79.337 bits (194), Expect = 2.217e-15
Identity = 37/65 (56.92%), Postives = 46/65 (70.77%), Query Frame = 0
Query:   20 DFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            DFNAK+GKR   EL+V  FGYG+RN    LLA F+E E L++MNSF RK +Q K TW+ P+G  K
Sbjct:  187 DFNAKIGKRDGGELRVGNFGYGQRNHRGHLLASFMEKEGLYMMNSFFRKQEQRKWTWISPDGVTK 251          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|357610206|gb|EHJ66868.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 75.8702 bits (185), Expect = 4.345e-14
Identity = 36/63 (57.14%), Postives = 45/63 (71.43%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNG 81
            GD NAKLGKR+  +LKV   G+G+RN   + LA F+E E LFVMNSF  KP Q K TW++P+G
Sbjct:   98 GDLNAKLGKRSAYQLKVGDCGHGQRNLRGQRLADFLEKEGLFVMNSFFEKPSQRKWTWMNPDG 160          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|357603460|gb|EHJ63789.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 70.0922 bits (170), Expect = 9.698e-13
Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGA 82
            G+FNAKLGKR+  ELKV  FG+G+RN   + LA F+  E LFVMNSF +K    K TW+ P+G+
Sbjct:   21 GEFNAKLGKRSAYELKVGDFGHGQRNLRGQRLADFLGKEGLFVMNSFFQKLSHRKWTWMSPDGS 84          
BLAST of OSCA025858-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 69.707 bits (169), Expect = 5.476e-12
Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = 0
Query:   19 GDFNAKLGKRTDNELKVELFGYGERNAGVRLLAGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIK 84
            GDFNAK+G R  +EL++  FGYG+RN   + L  F+E E L++MNSF +K    K TW+ P+G+ K
Sbjct:   18 GDFNAKVGTRNSDELRIGPFGYGQRNHRGQRLVDFMERERLYLMNSFFQKRPAKKWTWISPDGSTK 83          
The following BLAST results are available for this feature:
BLAST of OSCA025858-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 17
Match NameE-valueIdentityDescription
gi|827563895|ref|XP_012552454.1|8.077e-1859.09PREDICTED: craniofacial development protein 2-like... [more]
gi|298204325|gb|ADI61811.1|5.340e-1759.09endonuclease-reverse transcriptase [Bombyx mori][more]
gi|943952592|ref|XP_014359162.1|5.501e-1760.61PREDICTED: craniofacial development protein 2-like... [more]
gi|827556468|ref|XP_012549585.1|6.181e-1759.09PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|298204337|gb|ADI61817.1|1.086e-1660.61endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204327|gb|ADI61812.1|1.534e-1556.06endonuclease-reverse transcriptase [Bombyx mori][more]
gi|909577882|ref|XP_013144778.1|2.217e-1556.92PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|357610206|gb|EHJ66868.1|4.345e-1457.14endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357603460|gb|EHJ63789.1|9.698e-1354.69endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|838097688|gb|KLV34200.1|5.476e-1248.48hypothetical protein AB894_15325, partial [Pisciri... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
molecular_function GO:0003824 catalytic activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_22284contignewscf_22284:3373..3648 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025858-RAOSCA025858-RAOstrinia scapulalismRNAnewscf_22284 3373..3648 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025858-PA ID=OSCA025858-PA|Name=OSCA025858-RA|organism=Ostrinia scapulalis|type=polypeptide|length=91bp
MRIFSEPYILPVPFYRYDGDFNAKLGKRTDNELKVELFGYGERNAGVRLL
AGFVEWESLFVMNSFLRKPKQTKLTWLHPNGAIKMRSTSSC
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process