OSCA025860-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025860-RA
Unique NameOSCA025860-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length52
Homology
BLAST of OSCA025860-RA vs. genbank:protein
Match: gi|913331964|ref|XP_013197583.1| (PREDICTED: uncharacterized protein LOC106140531 [Amyelois transitella])

HSP 1 Score: 57.3806 bits (137), Expect = 4.487e-9
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 0
Query:    1 MLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWRRMTRRVDPK 52
            +L ++   R RGRP +TWM  I NDLK   +N +TT +R  WRR TRR DPK
Sbjct:   96 VLSMEEGRRPRGRPPMTWMQTIKNDLKSTCINKQTTHNRVVWRRNTRRADPK 147          
The following BLAST results are available for this feature:
BLAST of OSCA025860-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|913331964|ref|XP_013197583.1|4.487e-951.92PREDICTED: uncharacterized protein LOC106140531 [A... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_5859contignewscf_5859:6022..6180 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025860-RAOSCA025860-RAOstrinia scapulalismRNAnewscf_5859 6022..6180 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025860-PA ID=OSCA025860-PA|Name=OSCA025860-RA|organism=Ostrinia scapulalis|type=polypeptide|length=52bp
MLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWRRMTRRVD
PK
back to top