OSCA025863-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025863-RA
Unique NameOSCA025863-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length55
Homology
The following BLAST results are available for this feature:
BLAST of OSCA025863-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 23..26
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..10
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 27..55
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..26
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 11..22
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.593

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_4466contignewscf_4466:21189..21356 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025863-RAOSCA025863-RAOstrinia scapulalismRNAnewscf_4466 21189..21356 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025863-PA ID=OSCA025863-PA|Name=OSCA025863-RA|organism=Ostrinia scapulalis|type=polypeptide|length=55bp
MGKPLQPWMPLPWWFFFCQWLVSFRPSPKPKSSTVHPYYRKTLDEFLEYR
KKNKI
back to top