OSCA025864-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025864-RA
Unique NameOSCA025864-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length90
Homology
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|913323393|ref|XP_013192963.1| (PREDICTED: uncharacterized protein LOC106136849 [Amyelois transitella])

HSP 1 Score: 172.94 bits (437), Expect = 1.209e-54
Identity = 81/90 (90.00%), Postives = 89/90 (98.89%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQKA 90
            MEK+LDKVIEEIMSTPNVNGCLVADHQGLCLA+KGTAHVDSAG+IVA+S+QACK+QPNLKPPT+ LETDKKQCLIQRHGTITGAIFKQK+
Sbjct:    1 MEKELDKVIEEIMSTPNVNGCLVADHQGLCLASKGTAHVDSAGIIVALSDQACKLQPNLKPPTLSLETDKKQCLIQRHGTITGAIFKQKS 90          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|357616183|gb|EHJ70054.1| (hypothetical protein KGM_07380 [Danaus plexippus])

HSP 1 Score: 172.94 bits (437), Expect = 1.387e-54
Identity = 82/90 (91.11%), Postives = 87/90 (96.67%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQKA 90
            MEK+LDKV+EEIMSTPNVNGCLVADHQGLCLA+KG+AHVDSAG+IVAISEQACKIQPNLKPPTVCLETD K CLIQRHGTITGAIFKQK 
Sbjct:    1 MEKELDKVVEEIMSTPNVNGCLVADHQGLCLASKGSAHVDSAGIIVAISEQACKIQPNLKPPTVCLETDNKICLIQRHGTITGAIFKQKG 90          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|914558920|gb|KOB66865.1| (Uncharacterized protein OBRU01_20509 [Operophtera brumata])

HSP 1 Score: 172.17 bits (435), Expect = 2.483e-54
Identity = 80/88 (90.91%), Postives = 88/88 (100.00%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQ 88
            MEK+LDKVIEEIMSTPN+NGCLVADHQGLCLA+KG+AHVDSAG+IVAISEQACK+QPNLKPPTVCLET+KK+CLIQRHGTITGAIFKQ
Sbjct:    1 MEKELDKVIEEIMSTPNINGCLVADHQGLCLASKGSAHVDSAGIIVAISEQACKLQPNLKPPTVCLETEKKKCLIQRHGTITGAIFKQ 88          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|509176445|gb|JAA86343.1| (putative protein HBXIP-like protein [Pararge aegeria])

HSP 1 Score: 168.318 bits (425), Expect = 8.802e-53
Identity = 79/90 (87.78%), Postives = 86/90 (95.56%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQKA 90
            MEK+LDKV+EEIMSTPNV GCLVADHQGLCLA+KGTAHVDSAG+IVA+SEQACKI+PNLKPPTVCLETD K CLIQRHGTITGA+FKQK 
Sbjct:    1 MEKELDKVVEEIMSTPNVAGCLVADHQGLCLASKGTAHVDSAGLIVALSEQACKIEPNLKPPTVCLETDNKLCLIQRHGTITGAVFKQKG 90          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|943956044|ref|XP_014360926.1| (PREDICTED: ragulator complex protein LAMTOR5 homolog [Papilio machaon] >gi|930672685|gb|KPJ13262.1| Protein HBXIP-like [Papilio machaon])

HSP 1 Score: 167.162 bits (422), Expect = 2.376e-52
Identity = 77/89 (86.52%), Postives = 86/89 (96.63%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQK 89
            MEKDLDKV++EIM+TP +NGC+VADHQGLCLAAKGTAHVDSAG+IVA+SEQACKIQPNLKPPT+CLETDKK CL+QRHGTITGAIFK K
Sbjct:    1 MEKDLDKVVDEIMATPQINGCIVADHQGLCLAAKGTAHVDSAGIIVALSEQACKIQPNLKPPTICLETDKKLCLVQRHGTITGAIFKLK 89          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|512918530|ref|XP_004929156.1| (PREDICTED: ragulator complex protein LAMTOR5 [Bombyx mori])

HSP 1 Score: 167.162 bits (422), Expect = 2.652e-52
Identity = 79/89 (88.76%), Postives = 84/89 (94.38%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQK 89
            ME DLDKV+EEIMS PNVNGCL+AD QGLCLA+KG AHVDSAG+IVAISEQACKIQPN+KPPTVCLETDKKQCLIQRHGTITGAIFK K
Sbjct:    1 MENDLDKVVEEIMSMPNVNGCLIADPQGLCLASKGAAHVDSAGIIVAISEQACKIQPNMKPPTVCLETDKKQCLIQRHGTITGAIFKLK 89          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|910355523|ref|XP_013181452.1| (PREDICTED: ragulator complex protein LAMTOR5 homolog [Papilio xuthus] >gi|930656165|gb|KPI98491.1| Protein HBXIP-like [Papilio xuthus])

HSP 1 Score: 166.777 bits (421), Expect = 4.069e-52
Identity = 77/89 (86.52%), Postives = 86/89 (96.63%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQK 89
            MEKDLDKV++EIM+TP +NGC+VADHQGLCLAAKGTAHVDSAG+IVA+SEQACKIQPNLKPPT+CLETDKK CL+QRHGTITGAIFK K
Sbjct:    1 MEKDLDKVVDEIMATPQINGCIVADHQGLCLAAKGTAHVDSAGIIVALSEQACKIQPNLKPPTICLETDKKLCLVQRHGTITGAIFKLK 89          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|909582143|ref|XP_013147089.1| (PREDICTED: ragulator complex protein LAMTOR5 homolog [Papilio polytes])

HSP 1 Score: 166.007 bits (419), Expect = 8.126e-52
Identity = 77/89 (86.52%), Postives = 85/89 (95.51%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQK 89
            MEKDLDKV++EIM+TP +NGC+VADHQGLCLAAKGTAHVDSAG+IVAISEQACKI PNLKPPTVCLETDKK CL+QRHGTITGAIFK +
Sbjct:    1 MEKDLDKVVDEIMATPQINGCIVADHQGLCLAAKGTAHVDSAGIIVAISEQACKIHPNLKPPTVCLETDKKLCLVQRHGTITGAIFKLR 89          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|768418437|ref|XP_011549903.1| (PREDICTED: uncharacterized protein LOC105381799 [Plutella xylostella])

HSP 1 Score: 159.844 bits (403), Expect = 1.862e-49
Identity = 75/90 (83.33%), Postives = 83/90 (92.22%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQKA 90
            MEK+LD+V +EIM TPNV GC+ ADHQGLCLAAKG AHVDSAG+IVAISEQACKIQPNLKPPT+ LE DKKQCLIQRHGTITGAI+KQK+
Sbjct:    1 MEKELDRVTDEIMLTPNVTGCIFADHQGLCLAAKGNAHVDSAGLIVAISEQACKIQPNLKPPTINLEADKKQCLIQRHGTITGAIYKQKS 90          
BLAST of OSCA025864-RA vs. genbank:protein
Match: gi|1059407118|ref|XP_017776451.1| (PREDICTED: ragulator complex protein LAMTOR5-like [Nicrophorus vespilloides])

HSP 1 Score: 117.472 bits (293), Expect = 1.239e-32
Identity = 52/87 (59.77%), Postives = 71/87 (81.61%), Query Frame = 0
Query:    1 MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISEQACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFK 87
            MEK L++V+EEI++T +V GC+ ADHQGLCL  KG A  +SAGVI AI+E+A K++PN +PP + LE++ K C+IQR+GTITGAI+K
Sbjct:    1 MEKPLERVMEEILNTTDVFGCVFADHQGLCLGVKGRASTESAGVIGAIAEEASKLEPNSRPPVIVLESENKMCIIQRNGTITGAIYK 87          
The following BLAST results are available for this feature:
BLAST of OSCA025864-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913323393|ref|XP_013192963.1|1.209e-5490.00PREDICTED: uncharacterized protein LOC106136849 [A... [more]
gi|357616183|gb|EHJ70054.1|1.387e-5491.11hypothetical protein KGM_07380 [Danaus plexippus][more]
gi|914558920|gb|KOB66865.1|2.483e-5490.91Uncharacterized protein OBRU01_20509 [Operophtera ... [more]
gi|509176445|gb|JAA86343.1|8.802e-5387.78putative protein HBXIP-like protein [Pararge aeger... [more]
gi|943956044|ref|XP_014360926.1|2.376e-5286.52PREDICTED: ragulator complex protein LAMTOR5 homol... [more]
gi|512918530|ref|XP_004929156.1|2.652e-5288.76PREDICTED: ragulator complex protein LAMTOR5 [Bomb... [more]
gi|910355523|ref|XP_013181452.1|4.069e-5286.52PREDICTED: ragulator complex protein LAMTOR5 homol... [more]
gi|909582143|ref|XP_013147089.1|8.126e-5286.52PREDICTED: ragulator complex protein LAMTOR5 homol... [more]
gi|768418437|ref|XP_011549903.1|1.862e-4983.33PREDICTED: uncharacterized protein LOC105381799 [P... [more]
gi|1059407118|ref|XP_017776451.1|1.239e-3259.77PREDICTED: ragulator complex protein LAMTOR5-like ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0043066 negative regulation of apoptotic process
biological_process GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
biological_process GO:0019079 viral genome replication
cellular_component GO:0005737 cytoplasm
cellular_component GO:0071986 Ragulator complex
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024135Hepatitis B X-interacting proteinPRINTSPR02092HEPBVIRUSXIPcoord: 1..25
score: 35.29
coord: 27..48
score: 36.1
IPR024135Hepatitis B X-interacting proteinPANTHERPTHR13342FAMILY NOT NAMEDcoord: 1..90
NoneNo IPR availableSUPERFAMILY103196Roadblock/LC7 domaincoord: 3..50

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_17527contignewscf_17527:3752..4024 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025864-RAOSCA025864-RAOstrinia scapulalismRNAnewscf_17527 3752..4024 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025864-PA ID=OSCA025864-PA|Name=OSCA025864-RA|organism=Ostrinia scapulalis|type=polypeptide|length=90bp
MEKDLDKVIEEIMSTPNVNGCLVADHQGLCLAAKGTAHVDSAGVIVAISE
QACKIQPNLKPPTVCLETDKKQCLIQRHGTITGAIFKQKA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0071986Ragulator complex
GO:0005737cytoplasm
Vocabulary: Biological Process
TermDefinition
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0019079viral genome replication
GO:0043066negative regulation of apoptotic process
Vocabulary: INTERPRO
TermDefinition
IPR024135HBXIP