OSCA025866-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025866-RA
Unique NameOSCA025866-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length61
Homology
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|910347280|ref|XP_013177571.1| (PREDICTED: protein still life, isoform SIF type 1 [Papilio xuthus])

HSP 1 Score: 125.176 bits (313), Expect = 6.317e-32
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  516 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 576          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|357613402|gb|EHJ68488.1| (hypothetical protein KGM_16663 [Danaus plexippus])

HSP 1 Score: 124.79 bits (312), Expect = 6.730e-32
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  546 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 606          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|943962491|ref|XP_014363639.1| (PREDICTED: protein still life, isoform SIF type 1 isoform X1 [Papilio machaon])

HSP 1 Score: 124.79 bits (312), Expect = 7.449e-32
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  141 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 201          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|909571740|ref|XP_013141476.1| (PREDICTED: protein still life, isoform SIF type 1 [Papilio polytes])

HSP 1 Score: 124.79 bits (312), Expect = 7.746e-32
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  542 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 602          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|930670581|gb|KPJ11397.1| (Protein still life, isoform SIF type 1 [Papilio machaon])

HSP 1 Score: 123.635 bits (309), Expect = 7.997e-32
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  187 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 247          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|930655559|gb|KPI97887.1| (Protein still life, isoform SIF type 1 [Papilio xuthus])

HSP 1 Score: 124.405 bits (311), Expect = 9.850e-32
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  541 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 601          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|827559523|ref|XP_012550768.1| (PREDICTED: protein still life, isoform SIF type 1 [Bombyx mori])

HSP 1 Score: 124.02 bits (310), Expect = 1.388e-31
Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            KPCL+RQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  546 KPCLNRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 606          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|768423525|ref|XP_011552673.1| (PREDICTED: LOW QUALITY PROTEIN: protein still life, isoform SIF type 1 [Plutella xylostella])

HSP 1 Score: 122.094 bits (305), Expect = 7.896e-31
Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 0
Query:    2 PCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            PCLSRQASQS+ATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  150 PCLSRQASQSTATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 209          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|914568492|gb|KOB72420.1| (Still life [Operophtera brumata])

HSP 1 Score: 110.538 bits (275), Expect = 6.462e-27
Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
Query:    1 KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            +PC   Q SQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  411 EPC---QPSQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 468          
BLAST of OSCA025866-RA vs. genbank:protein
Match: gi|913296906|ref|XP_013186324.1| (PREDICTED: protein still life, isoform SIF type 1 [Amyelois transitella])

HSP 1 Score: 108.227 bits (269), Expect = 4.753e-26
Identity = 55/65 (84.62%), Postives = 56/65 (86.15%), Query Frame = 0
Query:    1 KPCLSRQASQ----SSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 61
            +PC  R   Q    SSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL
Sbjct:  536 EPCQRRDGRQHHHGSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMEDL 600          
The following BLAST results are available for this feature:
BLAST of OSCA025866-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910347280|ref|XP_013177571.1|6.317e-32100.00PREDICTED: protein still life, isoform SIF type 1 ... [more]
gi|357613402|gb|EHJ68488.1|6.730e-32100.00hypothetical protein KGM_16663 [Danaus plexippus][more]
gi|943962491|ref|XP_014363639.1|7.449e-32100.00PREDICTED: protein still life, isoform SIF type 1 ... [more]
gi|909571740|ref|XP_013141476.1|7.746e-32100.00PREDICTED: protein still life, isoform SIF type 1 ... [more]
gi|930670581|gb|KPJ11397.1|7.997e-32100.00Protein still life, isoform SIF type 1 [Papilio ma... [more]
gi|930655559|gb|KPI97887.1|9.850e-32100.00Protein still life, isoform SIF type 1 [Papilio xu... [more]
gi|827559523|ref|XP_012550768.1|1.388e-3198.36PREDICTED: protein still life, isoform SIF type 1 ... [more]
gi|768423525|ref|XP_011552673.1|7.896e-3198.33PREDICTED: LOW QUALITY PROTEIN: protein still life... [more]
gi|914568492|gb|KOB72420.1|6.462e-2791.80Still life [Operophtera brumata][more]
gi|913296906|ref|XP_013186324.1|4.753e-2684.62PREDICTED: protein still life, isoform SIF type 1 ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11483contignewscf_11483:3837..4019 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025866-RAOSCA025866-RAOstrinia scapulalismRNAnewscf_11483 3837..4019 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025866-PA ID=OSCA025866-PA|Name=OSCA025866-RA|organism=Ostrinia scapulalis|type=polypeptide|length=61bp
KPCLSRQASQSSATPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTF
EALLSQSMEDL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane