OSCA025867-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025867-RA
Unique NameOSCA025867-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length47
Homology
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|910319275|ref|XP_013162491.1| (PREDICTED: uncharacterized protein LOC106113978 [Papilio xuthus])

HSP 1 Score: 76.6406 bits (187), Expect = 8.460e-16
Identity = 35/46 (76.09%), Postives = 39/46 (84.78%), Query Frame = 0
Query:    2 LWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR 47
            LWNGLSSAVFP+ YDL +FKKRAY HLKGRQR C + G ADV+GRR
Sbjct:  199 LWNGLSSAVFPNRYDLGSFKKRAYHHLKGRQRICGSSGIADVHGRR 244          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|910347296|ref|XP_013177579.1| (PREDICTED: uncharacterized protein LOC106125039 [Papilio xuthus])

HSP 1 Score: 75.0998 bits (183), Expect = 1.213e-15
Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
Query:    2 LWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR 47
            LWNGLSSAVFP+ YDL +FKKRAY HLKGRQR C + G  DV+GRR
Sbjct:  145 LWNGLSSAVFPNQYDLGSFKKRAYHHLKGRQRICGSSGIVDVHGRR 190          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|910317225|ref|XP_013161376.1| (PREDICTED: uncharacterized protein LOC106113188, partial [Papilio xuthus])

HSP 1 Score: 75.485 bits (184), Expect = 2.964e-15
Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
Query:    2 LWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR 47
            LWNGLSSAVFP+ YDL +FKKRAY HLKGRQR C + G  DV+GRR
Sbjct:  209 LWNGLSSAVFPNQYDLGSFKKRAYHHLKGRQRICGSSGIVDVHGRR 254          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|223268545|emb|CAX36785.1| (hypothetical protein [Papilio dardanus])

HSP 1 Score: 67.781 bits (164), Expect = 1.231e-12
Identity = 33/46 (71.74%), Postives = 35/46 (76.09%), Query Frame = 0
Query:    2 LWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR 47
            LWN LSSAVFP+ YDL AFKKRAY  LKGRQ  C + G ADV GRR
Sbjct:  167 LWNTLSSAVFPNVYDLGAFKKRAYSSLKGRQHICGSSGIADVRGRR 212          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|930655127|gb|KPI97459.1| (Protein pangolin, isoforms A/H/I [Papilio xuthus])

HSP 1 Score: 64.3142 bits (155), Expect = 4.523e-12
Identity = 31/42 (73.81%), Postives = 33/42 (78.57%), Query Frame = 0
Query:    5 GLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGR 46
            GL SAVFP+ YDL +FKK AY HLKGRQRTC   G ADVYGR
Sbjct:   71 GLVSAVFPNRYDLGSFKKPAYQHLKGRQRTCGFSGIADVYGR 112          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|930655774|gb|KPI98102.1| (hypothetical protein RR46_11223 [Papilio xuthus])

HSP 1 Score: 65.0846 bits (157), Expect = 2.465e-11
Identity = 28/39 (71.79%), Postives = 33/39 (84.62%), Query Frame = 0
Query:    1 KLWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPG 39
            +LWNGLSSAVFP+ YDL +FK+RAY HLKGRQR C + G
Sbjct:  144 QLWNGLSSAVFPNRYDLGSFKRRAYHHLKGRQRICGSSG 182          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|930677715|gb|KPJ17754.1| (Maternal protein pumilio [Papilio machaon])

HSP 1 Score: 64.6994 bits (156), Expect = 5.496e-11
Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 0
Query:    1 KLWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADV 43
            +L + LSSAVFP+ YDL+AFKK+AY +LKGRQR C++ G ADV
Sbjct:  578 ELQDNLSSAVFPNSYDLEAFKKKAYTYLKGRQRNCDSSGVADV 620          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|930663408|gb|KPJ04944.1| (Aquaporin AQPcic [Papilio xuthus])

HSP 1 Score: 58.151 bits (139), Expect = 3.675e-9
Identity = 29/47 (61.70%), Postives = 35/47 (74.47%), Query Frame = 0
Query:    1 KLWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR 47
            +  +GLSSAVF + YDL  FKKRAY  LKGRQR C++ G ADV+G R
Sbjct:  143 RAADGLSSAVFSNQYDLGTFKKRAYHFLKGRQRICSSFGVADVHGCR 189          
BLAST of OSCA025867-RA vs. genbank:protein
Match: gi|433339045|dbj|BAM73877.1| (cytochrome P450, partial [Bombyx mori])

HSP 1 Score: 55.8398 bits (133), Expect = 7.640e-9
Identity = 25/47 (53.19%), Postives = 33/47 (70.21%), Query Frame = 0
Query:    1 KLWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR 47
            +LWN L S VFP+ YD+  FK+  +  L GRQR  +APG A+V+GRR
Sbjct:   57 RLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR 103          
The following BLAST results are available for this feature:
BLAST of OSCA025867-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 9
Match NameE-valueIdentityDescription
gi|910319275|ref|XP_013162491.1|8.460e-1676.09PREDICTED: uncharacterized protein LOC106113978 [P... [more]
gi|910347296|ref|XP_013177579.1|1.213e-1573.91PREDICTED: uncharacterized protein LOC106125039 [P... [more]
gi|910317225|ref|XP_013161376.1|2.964e-1573.91PREDICTED: uncharacterized protein LOC106113188, p... [more]
gi|223268545|emb|CAX36785.1|1.231e-1271.74hypothetical protein [Papilio dardanus][more]
gi|930655127|gb|KPI97459.1|4.523e-1273.81Protein pangolin, isoforms A/H/I [Papilio xuthus][more]
gi|930655774|gb|KPI98102.1|2.465e-1171.79hypothetical protein RR46_11223 [Papilio xuthus][more]
gi|930677715|gb|KPJ17754.1|5.496e-1165.12Maternal protein pumilio [Papilio machaon][more]
gi|930663408|gb|KPJ04944.1|3.675e-961.70Aquaporin AQPcic [Papilio xuthus][more]
gi|433339045|dbj|BAM73877.1|7.640e-953.19cytochrome P450, partial [Bombyx mori][more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_46644contignewscf_46644:4..147 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025867-RAOSCA025867-RAOstrinia scapulalismRNAnewscf_46644 4..147 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025867-PA ID=OSCA025867-PA|Name=OSCA025867-RA|organism=Ostrinia scapulalis|type=polypeptide|length=47bp
KLWNGLSSAVFPDGYDLQAFKKRAYLHLKGRQRTCNAPGTADVYGRR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane