OSCA025868-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025868-RA
Unique NameOSCA025868-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length55
Homology
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 89.7373 bits (221), Expect = 4.880e-20
Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            PRAGRRSVG+PP RWTDDLVKV    WM+AAQD SLWK LGEAFVQQWTSF
Sbjct:  312 PRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 362          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 90.5077 bits (223), Expect = 6.559e-20
Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            PRAGRRSVG+PP RWTDDLVKV    WM+AAQD SLWK LGEAFVQQWTSF
Sbjct:  446 PRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 496          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 90.1225 bits (222), Expect = 6.592e-20
Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            PRAGRRSVG+PP RWTDDLVKV    WM+AAQD SLWK LGEAFVQQWTSF
Sbjct:  427 PRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 477          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 87.4261 bits (215), Expect = 1.225e-19
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTS 53
            PR GRRSVGKPP RWTDDLVKV    WMRAAQD +LW+ +GEA+VQQWTS
Sbjct:   44 PRTGRRSVGKPPARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTS 93          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 78.1814 bits (191), Expect = 4.724e-18
Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            PR GRRSVG+PP RWTDDLVKV   +WMR AQD S W+ LGEA+VQQW S 
Sbjct:   14 PRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASH 64          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 83.9593 bits (206), Expect = 1.186e-17
Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            PR GRRSVG+PP RWTDDLVKV    WMRAAQD +LW+ +GEA+VQQWT++
Sbjct:  719 PRIGRRSVGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTY 769          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 75.8702 bits (185), Expect = 4.881e-17
Identity = 36/49 (73.47%), Postives = 40/49 (81.63%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWT 52
            PR GRRSVG+PP RWTDDLVKV    WM AAQD SLW+ +GEA+VQQWT
Sbjct:   22 PRTGRRSVGRPPARWTDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWT 70          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 76.2554 bits (186), Expect = 4.907e-17
Identity = 35/50 (70.00%), Postives = 39/50 (78.00%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTS 53
            PR GRRSVG+PP RWTDDLVKV   +WMR AQD S W+ LGEA+ QQW S
Sbjct:   31 PRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWAS 80          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 76.6406 bits (187), Expect = 2.702e-16
Identity = 34/51 (66.67%), Postives = 40/51 (78.43%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            PR G+RSVG+PP RWTDD+VK     WMRAA D + WK LGEA+VQQWTS+
Sbjct:  109 PRTGKRSVGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSY 159          
BLAST of OSCA025868-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 73.1738 bits (178), Expect = 4.961e-16
Identity = 34/51 (66.67%), Postives = 38/51 (74.51%), Query Frame = 0
Query:    4 PRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQWTSF 54
            P  GRRSVG+PP RWTDDLVKV   +WMR AQD S W+ LGEA+ QQW S 
Sbjct:   14 PWTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASH 64          
The following BLAST results are available for this feature:
BLAST of OSCA025868-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|4.880e-2082.35reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|6.559e-2082.35reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|6.592e-2082.35reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930659181|gb|KPJ01280.1|1.225e-1976.00hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|930681186|gb|KPJ20726.1|4.724e-1870.59hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|909577882|ref|XP_013144778.1|1.186e-1770.59PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|930681500|gb|KPJ21040.1|4.881e-1773.47hypothetical protein RR48_00071 [Papilio machaon][more]
gi|930648975|gb|KPI91323.1|4.907e-1770.00hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|825740785|ref|WP_047149388.1|2.702e-1666.67hypothetical protein, partial [Escherichia coli][more]
gi|930654247|gb|KPI96582.1|4.961e-1666.67hypothetical protein RR46_12612 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_41470contignewscf_41470:824..991 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025868-RAOSCA025868-RAOstrinia scapulalismRNAnewscf_41470 824..991 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025868-PA ID=OSCA025868-PA|Name=OSCA025868-RA|organism=Ostrinia scapulalis|type=polypeptide|length=55bp
MVGPRAGRRSVGKPPIRWTDDLVKVTEGAWMRAAQDLSLWKFLGEAFVQQ
WTSFD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity