OSCA025871-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025871-RA
Unique NameOSCA025871-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length46
Homology
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 76.6406 bits (187), Expect = 2.728e-15
Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            PTRWTDDLVKVAG  WM+AAQDRSLWK+L EAFVQQWTSF
Sbjct:  457 PTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 496          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 76.2554 bits (186), Expect = 2.916e-15
Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            PTRWTDDLVKVAG  WM+AAQDRSLWK+L EAFVQQWTSF
Sbjct:  323 PTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 362          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 76.6406 bits (187), Expect = 3.008e-15
Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            PTRWTDDLVKVAG  WM+AAQDRSLWK+L EAFVQQWTSF
Sbjct:  438 PTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 477          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 72.7886 bits (177), Expect = 2.391e-14
Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFVE 42
            P RWTDDLVKVAG  WMRAAQDR+LW+++ EA+VQQWTS  E
Sbjct:   55 PARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTSHRE 96          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 69.707 bits (169), Expect = 8.543e-13
Identity = 29/40 (72.50%), Postives = 36/40 (90.00%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            P RWTDDLVKVAG  WMRAAQDR+LW+++ EA+VQQWT++
Sbjct:  730 PARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTY 769          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 64.3142 bits (155), Expect = 1.314e-12
Identity = 29/40 (72.50%), Postives = 33/40 (82.50%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            P RWTDDLVKVAG +WMR AQDRS W++L EA+VQQW S 
Sbjct:   25 PARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASH 64          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|930668226|gb|KPJ09267.1| (hypothetical protein RR48_15408 [Papilio machaon])

HSP 1 Score: 68.5514 bits (166), Expect = 2.428e-12
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 0
Query:    3 RWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQW 37
            RWTDDLVKVAG  WMR AQDRSLW++L EA+ QQW
Sbjct:   15 RWTDDLVKVAGVCWMRVAQDRSLWRSLREAYAQQW 49          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 65.0846 bits (157), Expect = 4.315e-12
Identity = 28/40 (70.00%), Postives = 34/40 (85.00%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            P RWTDD+VK AG+ WMRAA DR+ WK+L EA+VQQWTS+
Sbjct:  120 PARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSY 159          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 62.7734 bits (151), Expect = 5.178e-12
Identity = 29/38 (76.32%), Postives = 33/38 (86.84%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWT 38
            P RWTDDLVKVAG  WM AAQDRSLW+++ EA+VQQWT
Sbjct:   33 PARWTDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWT 70          
BLAST of OSCA025871-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 62.3882 bits (150), Expect = 7.043e-12
Identity = 28/40 (70.00%), Postives = 32/40 (80.00%), Query Frame = 0
Query:    1 PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSF 40
            P RWTDDLVKVAG +WMR AQDRS W++L EA+ QQW S 
Sbjct:   25 PARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASH 64          
The following BLAST results are available for this feature:
BLAST of OSCA025871-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001323|gb|ABO45239.1|2.728e-1587.50reverse transcriptase [Ostrinia nubilalis][more]
gi|134001247|gb|ABO45233.1|2.916e-1587.50reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001215|gb|ABO45231.1|3.008e-1587.50reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930659181|gb|KPJ01280.1|2.391e-1473.81hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|909577882|ref|XP_013144778.1|8.543e-1372.50PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|930681186|gb|KPJ20726.1|1.314e-1272.50hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930668226|gb|KPJ09267.1|2.428e-1277.14hypothetical protein RR48_15408 [Papilio machaon][more]
gi|825740785|ref|WP_047149388.1|4.315e-1270.00hypothetical protein, partial [Escherichia coli][more]
gi|930681500|gb|KPJ21040.1|5.178e-1276.32hypothetical protein RR48_00071 [Papilio machaon][more]
gi|930654247|gb|KPI96582.1|7.043e-1270.00hypothetical protein RR46_12612 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
cellular_component GO:0005634 nucleus
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0003964 RNA-directed DNA polymerase activity
molecular_function GO:0008270 zinc ion binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_13850contignewscf_13850:3..143 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025871-RAOSCA025871-RAOstrinia scapulalismRNAnewscf_13850 3..143 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025871-PA ID=OSCA025871-PA|Name=OSCA025871-RA|organism=Ostrinia scapulalis|type=polypeptide|length=46bp
PTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFVENDSI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis