OSCA025873-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025873-RA
Unique NameOSCA025873-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length54
Homology
BLAST of OSCA025873-RA vs. genbank:protein
Match: gi|913335576|ref|XP_013199561.1| (PREDICTED: golgin subfamily A member 4-like isoform X5 [Amyelois transitella])

HSP 1 Score: 60.8474 bits (146), Expect = 1.455e-9
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0
Query:    3 SPE-SPPTPRNENLVELLGIWESLEAHSRAEDAALKRVRDLEMQRAQLKDVAQ 54
            SP+ SPP+PR     EL G+WE L A  RAEDAALKR+ DLEMQR QL++VAQ
Sbjct: 1320 SPDVSPPSPR---AGELAGVWECLLAQWRAEDAALKRIADLEMQREQLRNVAQ 1369          
BLAST of OSCA025873-RA vs. genbank:protein
Match: gi|913335572|ref|XP_013199559.1| (PREDICTED: golgin subfamily A member 4-like isoform X3 [Amyelois transitella])

HSP 1 Score: 60.8474 bits (146), Expect = 1.469e-9
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0
Query:    3 SPE-SPPTPRNENLVELLGIWESLEAHSRAEDAALKRVRDLEMQRAQLKDVAQ 54
            SP+ SPP+PR     EL G+WE L A  RAEDAALKR+ DLEMQR QL++VAQ
Sbjct: 1330 SPDVSPPSPR---AGELAGVWECLLAQWRAEDAALKRIADLEMQREQLRNVAQ 1379          
BLAST of OSCA025873-RA vs. genbank:protein
Match: gi|913335568|ref|XP_013199557.1| (PREDICTED: golgin subfamily A member 4-like isoform X1 [Amyelois transitella])

HSP 1 Score: 60.8474 bits (146), Expect = 1.469e-9
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0
Query:    3 SPE-SPPTPRNENLVELLGIWESLEAHSRAEDAALKRVRDLEMQRAQLKDVAQ 54
            SP+ SPP+PR     EL G+WE L A  RAEDAALKR+ DLEMQR QL++VAQ
Sbjct: 1346 SPDVSPPSPR---AGELAGVWECLLAQWRAEDAALKRIADLEMQREQLRNVAQ 1395          
BLAST of OSCA025873-RA vs. genbank:protein
Match: gi|913335570|ref|XP_013199558.1| (PREDICTED: golgin subfamily A member 4-like isoform X2 [Amyelois transitella])

HSP 1 Score: 60.8474 bits (146), Expect = 1.498e-9
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0
Query:    3 SPE-SPPTPRNENLVELLGIWESLEAHSRAEDAALKRVRDLEMQRAQLKDVAQ 54
            SP+ SPP+PR     EL G+WE L A  RAEDAALKR+ DLEMQR QL++VAQ
Sbjct: 1340 SPDVSPPSPR---AGELAGVWECLLAQWRAEDAALKRIADLEMQREQLRNVAQ 1389          
BLAST of OSCA025873-RA vs. genbank:protein
Match: gi|913335574|ref|XP_013199560.1| (PREDICTED: golgin subfamily A member 4-like isoform X4 [Amyelois transitella])

HSP 1 Score: 60.8474 bits (146), Expect = 1.528e-9
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0
Query:    3 SPE-SPPTPRNENLVELLGIWESLEAHSRAEDAALKRVRDLEMQRAQLKDVAQ 54
            SP+ SPP+PR     EL G+WE L A  RAEDAALKR+ DLEMQR QL++VAQ
Sbjct: 1323 SPDVSPPSPR---AGELAGVWECLLAQWRAEDAALKRIADLEMQREQLRNVAQ 1372          
The following BLAST results are available for this feature:
BLAST of OSCA025873-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 5
Match NameE-valueIdentityDescription
gi|913335576|ref|XP_013199561.1|1.455e-964.15PREDICTED: golgin subfamily A member 4-like isofor... [more]
gi|913335572|ref|XP_013199559.1|1.469e-964.15PREDICTED: golgin subfamily A member 4-like isofor... [more]
gi|913335568|ref|XP_013199557.1|1.469e-964.15PREDICTED: golgin subfamily A member 4-like isofor... [more]
gi|913335570|ref|XP_013199558.1|1.498e-964.15PREDICTED: golgin subfamily A member 4-like isofor... [more]
gi|913335574|ref|XP_013199560.1|1.528e-964.15PREDICTED: golgin subfamily A member 4-like isofor... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_27456contignewscf_27456:67..228 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025873-RAOSCA025873-RAOstrinia scapulalismRNAnewscf_27456 67..228 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025873-PA ID=OSCA025873-PA|Name=OSCA025873-RA|organism=Ostrinia scapulalis|type=polypeptide|length=54bp
VKSPESPPTPRNENLVELLGIWESLEAHSRAEDAALKRVRDLEMQRAQLK
DVAQ
back to top